Difference between revisions of "Os04g0517100"

From RiceWiki
Jump to: navigation, search
m (Function)
(Structured Information)
 
(8 intermediate revisions by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The gene OSmyb4 is well known as it's role in cold tolerance.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
The OSmyb4 cDNA of rice(cv.Arborio) was isolated from a coleoptile cDNA library[1].
+
The OSmyb4 cDNA of rice(cv.Arborio) was isolated from a coleoptile cDNA library[1]. OSmyb4 is a rice transcription factor, belonging to the Myb family and induced by cold treatment.The study unveiled that Myb4 overexpressing plants show a significant increased cold and freezing tolerance, measured as membrane or Photosystem II (PSII) stability and as whole plant tolerance,But the expression of Osmyb4 in rice is induced only by cold treatment and not by other abiotic stresses or by the ABA hormone, indicating that its function is specifically related to the ABA-independent cold response[1].However ,another study showed that Osmyb4 up-regulated 254 genes, 22% of which encode proteins involved in gene expression regulation and signal transduction by microarray approach, suggesting an upstream role of Myb4 in stress response. Most of the up-regulated genes are known to be involved in tolerance not only to cold, but also to other abiotic and environmental stresses (drought, salt, oxidative stresses). Moreover, a high proportion has known functions in resistance to pathogen attacks[3]. In Osmyb4 transgenic plants, the expression of genes participating in different cold‐induced pathways is affected, suggesting that Myb4 represents a master switch in cold tolerance. The constitutive expression of OSmyb4 in Arabidopsis thaliana results in improved cold and freezing tolerance.while in tomato plants overexpressing Osmyb4 acquired a higher tolerance to drought stress and to virus disease. However, the transgenic plants did not appear to be more cold tolerant than the WT[2].
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
The expression of the gene Osmyb4, detected at low level in coleoptiles grown for 3 days at 29°C,but OSmyb4 mRNA was strongly increased after a 4-h treatment at 4℃ in 3-day rice coleoptiles, otherwise, neither salt, drought, high tempture or anoxia , nor treatment with ABA and IAA affected OSmyb4 expression . Anaerobically germinated rice did not express OSmyb4.
  
 
===Evolution===
 
===Evolution===
Line 14: Line 14:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
 
 +
1 Dipartimento di Biologia Strutturale e Funzionale, Università dell'Insubria, via J.H. Dunant 3, 21100 Varese, Italy
 +
2 Istituto di Biologia e Biotecnologia Agraria, C.N.R., via E. Bassini 15, 20133, Milano, Italy
  
 
==References==
 
==References==
Line 20: Line 22:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0517100|
 
Description = Similar to Y19 protein|
 
Version = NM_001059853.1 GI:115459435 GeneID:4336407|
 
Length = 1819 bp|
 
Definition = Oryza sativa Japonica Group Os04g0517100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:26241584..26243402|
 
CDS = 26241917..26242427,26242974..26243103,26243192..26243324|
 
GCID = <gbrowseImage1>
 
name=NC_008397:26241584..26243402
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:26241584..26243402
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggggagggctccgtgctgcgagaagatggggctcaagaagggtccatggacgccggaggaggacaaggtcctcgtcgcccacatccagcgccacggccacggcaactggcgcgccctgcccaagcaagccgggctgctgcgttgcggcaagagctgccggctccggtggatcaactacctgcggccggacatcaagcggggcaacttctccaaggaggaggaggacaccatcatccatctccacgagctgcttggcaacaggtggtccgcaattgccgccaggttgcccgggaggacggacaacgagatcaagaacgtgtggcacacccacctcaagaagcgcctcgatgcgccggctcagggcggtcatgtcgcggcgagcggcggcaagaagcacaagaagccgaagagcgcgaagaagccagccgccgccgccgccgcgccgccggcgtcgcccgagcggtccgcctcgtcgtcggtgacggagtcctcgatggcctcgtcggtggcggaggagcacggcaacgccgggatcagctcggcgtccgcgtccgtgtgcgccaaggaggagagctccttcacctcggcttccgaggagttccagatcgacgacagcttctggtcggagacgctgtcgatgccgctggacgggtacgacgtgtccatggagcccggcgacgcgttcgtcgcgccgccatccgccgacgacatggactactggctcggagtgttcatggagtccggcgaagcgcaagacttgccgcagatctag</cdnaseq>|
 
AA = <aaseq>MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQA                    GLLRCGKSCRLRWINYLRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDN                    EIKNVWHTHLKKRLDAPAQGGHVAASGGKKHKKPKSAKKPAAAAAAPPASPERSASSS                    VTESSMASSVAEEHGNAGISSASASVCAKEESSFTSASEEFQIDDSFWSETLSMPLDG                    YDVSMEPGDAFVAPPSADDMDYWLGVFMESGEAQDLPQI</aaseq>|
 
DNA = <dnaseqindica>976..1486#300..429#79..211#cagccgcctcccttccaagaacacacaacgcaagaggagcagagcagttcagatcagagcagggaaggagcaagcacaatggggagggctccgtgctgcgagaagatggggctcaagaagggtccatggacgccggaggaggacaaggtcctcgtcgcccacatccagcgccacggccacggcaactggcgcgccctgcccaagcaagccggtgagtgacagcggctcgtgttcggttcaggtcgtgtacctttggcggcgccggtgaagcaaagctaaaatgggttttgatgtcgcagggctgctgcgttgcggcaagagctgccggctccggtggatcaactacctgcggccggacatcaagcggggcaacttctccaaggaggaggaggacaccatcatccatctccacgagctgcttggcaacaggtacacacgctgctctgctcctccttaattgcagacttatctgatctgatccccccaaatttcgctgctcctggtttggagcaatgattgttgcttgcttatgtgcttcaaatgctatgagagggaggtttattccttttttatttatttagttattattagttatttattaccattgtggaggggcatatactgatatgttatcctcctgggccacctgctctcgatgcaaatagagagaaaatatattgctagtcgtaggccacttttctgtagctaattacatcactgatgatgcgcgagatgtgctaaaagattccatcttgtttggctcttccggtgaccccccttgaattcagcgctgcaaaaacatgcgctttgcattaaacaaccgcatgtgatcccgacgagggaatcaaatcacgcgatgatagcaaagctctaaatcaaaatgaagtcatctgaaatagccaaacaattttttttttttgacaaaatgaaacatgaacttgggcactgatccgctctgaattctgtgctacgcaggtggtccgcaattgccgccaggttgcccgggaggacggacaacgagatcaagaacgtgtggcacacccacctcaagaagcgcctcgatgcgccggctcagggcggtcatgtcgcggcgagcggcggcaagaagcacaagaagccgaagagcgcgaagaagccagccgccgccgccgccgcgccgccggcgtcgcccgagcggtccgcctcgtcgtcggtgacggagtcctcgatggcctcgtcggtggcggaggagcacggcaacgccgggatcagctcggcgtccgcgtccgtgtgcgccaaggaggagagctccttcacctcggcttccgaggagttccagatcgacgacagcttctggtcggagacgctgtcgatgccgctggacgggtacgacgtgtccatggagcccggcgacgcgttcgtcgcgccgccatccgccgacgacatggactactggctcggagtgttcatggagtccggcgaagcgcaagacttgccgcagatctagagaaagagagagaattttaccgtttcttcggttaattgatttgttttttctctctctgccgccatcttgcaccggagggacatagctaacagacaagagtgtccatgagcgaatcatcaagcaggaagaacgcgaatcatgcgatgcgatgcgatgagatgcacccagtagctttgatagttaattttctttttttacctccttcctgtatgtatagaaacagaagagatcagtgatcgaaacctgagatcctttctcacaatgtgcaaactggatcatcagaaaacgggctctgcgtttctcatttgattaattaaattcaacttgcacgct</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059853.1 RefSeq:Os04g0517100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:07, 12 June 2015

The gene OSmyb4 is well known as it's role in cold tolerance.

Annotated Information

Function

The OSmyb4 cDNA of rice(cv.Arborio) was isolated from a coleoptile cDNA library[1]. OSmyb4 is a rice transcription factor, belonging to the Myb family and induced by cold treatment.The study unveiled that Myb4 overexpressing plants show a significant increased cold and freezing tolerance, measured as membrane or Photosystem II (PSII) stability and as whole plant tolerance,But the expression of Osmyb4 in rice is induced only by cold treatment and not by other abiotic stresses or by the ABA hormone, indicating that its function is specifically related to the ABA-independent cold response[1].However ,another study showed that Osmyb4 up-regulated 254 genes, 22% of which encode proteins involved in gene expression regulation and signal transduction by microarray approach, suggesting an upstream role of Myb4 in stress response. Most of the up-regulated genes are known to be involved in tolerance not only to cold, but also to other abiotic and environmental stresses (drought, salt, oxidative stresses). Moreover, a high proportion has known functions in resistance to pathogen attacks[3]. In Osmyb4 transgenic plants, the expression of genes participating in different cold‐induced pathways is affected, suggesting that Myb4 represents a master switch in cold tolerance. The constitutive expression of OSmyb4 in Arabidopsis thaliana results in improved cold and freezing tolerance.while in tomato plants overexpressing Osmyb4 acquired a higher tolerance to drought stress and to virus disease. However, the transgenic plants did not appear to be more cold tolerant than the WT[2].

Expression

The expression of the gene Osmyb4, detected at low level in coleoptiles grown for 3 days at 29°C,but OSmyb4 mRNA was strongly increased after a 4-h treatment at 4℃ in 3-day rice coleoptiles, otherwise, neither salt, drought, high tempture or anoxia , nor treatment with ABA and IAA affected OSmyb4 expression . Anaerobically germinated rice did not express OSmyb4.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1 Dipartimento di Biologia Strutturale e Funzionale, Università dell'Insubria, via J.H. Dunant 3, 21100 Varese, Italy 2 Istituto di Biologia e Biotecnologia Agraria, C.N.R., via E. Bassini 15, 20133, Milano, Italy

References

Please input cited references here.

Structured Information