|
|
| (5 intermediate revisions by one other user not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| + | GLR3.1, a Glu receptor–like gene, serves an important function in maintaining normal cell division activity and cell survival during rice seedling root development. The deduced amino acid sequence indicates that the GLR3.1 gene encodes a typical Glu receptor–like protein with close sequence and structural similarities to animal iGluRs. The extracellular |
| − | GLR3.1, a Glu receptor–like gene, | + | and cytoplasmic segments of iGluRs are thought to be available for ligand recognition, cytoplasmic modification, or interactions between the receptor and cytoplasmic proteins. The channel pore, which is formed by three membrane-spanning domains and one reentrant membrane loop, defines channel properties such as ion selectivity, permeability, and conductance. In the channel pore, the M2 loop is the structural basis for the ion selectivity filter. The identification of a distinctive exon–intron structure, which was found in the kainite subgroup of iGluRs and in clade III plant GLRs, indicates that the structure of the M2 loop might have emerged before the divergence of animals and plants. |
| − | serves an important function in maintaining normal cell division | |
| − | activity and cell survival during rice seedling root development. | |
| − | The deduced amino acid sequence indicates that the GLR3.1 | |
| − | gene encodes a typical Glu receptor–like protein with close sequence | |
| − | and structural similarities to animal iGluRs. The extracellular | |
| − | and cytoplasmic segments of iGluRs are thought to | |
| − | be available for ligand recognition, cytoplasmic modification, or | |
| − | interactions between the receptor and cytoplasmic proteins. The | |
| − | channel pore, which is formed by three membrane-spanning | |
| − | domains and one reentrant membrane loop, defines channel | |
| − | properties such as ion selectivity, permeability, and conductance. | |
| − | In the channel pore, the M2 loop is the structural basis for | |
| − | the ion selectivity filter (Dingledine et al., 1999). The identification | |
| − | of a distinctive exon–intron structure, which was found in the | |
| − | kainite subgroup of iGluRs and in clade III plant GLRs, indicates | |
| − | that the structure of the M2 loop might have emerged before the | |
| − | divergence of animals and plants. | |
| | | | |
| | ===Expression=== | | ===Expression=== |
| | Please input expression information here. | | Please input expression information here. |
| − | It expresses in root at a very low concentration, by using RT-PCR method to detect its expression. | + | It expresses in root at a very low concentration, by using RT-PCR method can detect its expression. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Alignment analysis showed a high similarity between rice GLR3.1 and 20 members of the Arabidopsis GLR family, especially in the M3 transmembrane domain (Figure 1). In the rice GLR3.1 protein sequence, we have identified all of the 37 invariant amino acid residues that are absolutely conserved in the Arabidopsis GLR family. Phylogenetic analysis of rice GLR3.1 with the entire GLR familyfrom Arabidopsis and the entire iGluR family from rat indicates that GLR3.1 is evolutionarily close to the clade III Arabidopsis GLRs. | + | Alignment analysis showed a high similarity between rice GLR3.1 and 20 members of the Arabidopsis GLR family, especially in the M3 transmembrane domain (Figure 1). In the rice GLR3.1 protein sequence, we have identified all of the 37 invariant amino acid residues that are absolutely conserved in the Arabidopsis GLR family. Phylogenetic analysis of rice GLR3.1 with the entire GLR familyfrom Arabidopsis and the entire iGluR family from rat indicates that GLR3.1 is evolutionarily close to the clade III Arabidopsis GLRs.[[File:进化1.jpg|left|thumb|2000px|'figure1 :Phylogenetic Tree Generated from Parsimony Analysis of Amino Acid Sequences of Rat iGluRs, Arabidopsis GLRs, and Rice GLR3.1 with synGluR0 as the Outgroup. |
| − |
| + | Rice GLR3.1 marked by the asterisk. The numbers at the nodes are bootstrap values. Rice GLR3.1 was most similar to clade III of the GLRs. AMPA, a-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid; KA, kainate; NMDA, N-methyl-D-aspartate.]] |
| − | [[File:进化1.jpg]] | |
| − | | |
| − | Phylogenetic Tree Generated from Parsimony Analysis of Amino Acid Sequences of Rat iGluRs, Arabidopsis GLRs, and Rice GLR3.1 with synGluR0 as the Outgroup.
| |
| − | Rice GLR3.1 marked by the asterisk. The numbers at the nodes are bootstrap values. Rice GLR3.1 was most similar to clade III of the GLRs. AMPA, a-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid; KA, kainate; NMDA, N-methyl-D-aspartate. | |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| Line 44: |
Line 23: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os04g0585200|
| |
| − | Description = Similar to Glutamate receptor 3.3 precursor (Ligand-gated ion channel 3.3)|
| |
| − | Version = NM_001060211.1 GI:115460151 GeneID:4336789|
| |
| − | Length = 4634 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os04g0585200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
| |
| − | AP = Chromosome 4:29964265..29968898|
| |
| − | CDS = 29964455..29964943,29965442..29965848,29965948..29965979,29966126..29966244|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008397:29964265..29968898
| |
| − | source=RiceChromosome04
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008397:29964265..29968898
| |
| − | source=RiceChromosome04
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgtggaccgtcactggactgttctttcttatcatagggacagtagtttggatgcttgaacatagaatcaatgatgaattccgtggccctcctgcgaaacagcttattactgtgttctggttcagtttctcaactctgtttttcgcacacagagaggacaccaggagcactctcggccgcttcgtgatcatcatatggctgttcgtcgttctgatcatccagtcgagctacactgccagcctgacctccatactcaccgtgcagcagctcacgtcgccgatcaccgggatcgacagcttgatcaccagcgacgttcccatcgggtttcaggtcgggtccttcgcggagaactacctcgcccaggagctcggcgttgcccactcgaggcttaaggcgctcggctcaccagaggagtacaagaaggcacttgaccttggccccagcaaaggaggcgttgcggccatcgtcgacgagcgcccgtacattgagctcttcttgtatcagaaccctaagttcgccgtcgtgggctccgagttcaccaagagcggctggggcttcgcgttcccgagggactcgccgctgtcagtggacctgtcgacggcgatcctggagctgtcggagaacggcgacctgcagaggatccacgacaagtggctggcgagcgacatgtcgtccatgtcgcaggccagcgagctggatcaggatccggaccggctggacgtgtacagcttctcggcgctgttcctcatctgcggcctcgcctgcatcttcgccctcgccatacacgcctgcaacctcttctaccagtactcccgccacgccgcggaggaggaccccgctgcgctgcagccgtccgccagcgacggcagccgctccctctcccggcgcagcaagctccagtccttcctgtccttcgccgaccgccgggaagccgacatccggagggcggccaaggagaaggcgtctggtctgggcggcagcggagggtccatgagcggcgtcagcttcacgtcaagcggcagcggcagcaccaccgcttcatgctaa</cdnaseq>|
| |
| − | AA = <aaseq>MWTVTGLFFLIIGTVVWMLEHRINDEFRGPPAKQLITVFWFSFS TLFFAHREDTRSTLGRFVIIIWLFVVLIIQSSYTASLTSILTVQQLTSPITGIDSLIT SDVPIGFQVGSFAENYLAQELGVAHSRLKALGSPEEYKKALDLGPSKGGVAAIVDERP YIELFLYQNPKFAVVGSEFTKSGWGFAFPRDSPLSVDLSTAILELSENGDLQRIHDKW LASDMSSMSQASELDQDPDRLDVYSFSALFLICGLACIFALAIHACNLFYQYSRHAAE EDPAALQPSASDGSRSLSRRSKLQSFLSFADRREADIRRAAKEKASGLGGSGGSMSGV SFTSSGSGSTTASC</aaseq>|
| |
| − | DNA = <dnaseqindica>3956..4444#3051..3457#2920..2951#2655..2773#ctgggctccaaacagttgccatgatatagctaggcgaactgcaagcgaggtcttgagaaacagaacccgctgcagtggcacatttggtgaggcttcgggaggtcaccagaattgttcctgttcacacgggctgctagttcttcacagctatctcgtgtcatccgagcagaagcaactacctaccaataagaggttgcttcagacccaaatggtaagaggaactgtacctgaatccacataaagaaaaggggaaaggggagaggttcagttccatggggatttgtttgtttaagctgtatgtgccacactttcttattcctgaaaagaagattggtttccctcttcaacttcatactccgatgttcttgcccctctatagctcattaaaaagttagtagttgagttcatctcagctgctcttcttctggttcttttatcttttgtttttttggtggttccttgcaagtgctttttctcgaggaatgtcccttttggttctgttgcctgttggacctcagttcttatttatttaatgatttgtgctcctctgtaacctggtgttctcgctttctaatctgtaacgctatacctgtgcttaacaggcatcgtcaggaatttttcctcggttattccagcatgtgcgttgttacgttgaaggatgaattccaaaagagcactacattaatcctctaggtcactttgtcaccatgaagttcattttctatctgttcagtattttctgttgtctgtgttcctgcgcacaaagccaaaacatctctgggaggcccgatgcagtgagaattggagctcagttcgcaaggaattcaacaattgggagagttgccgcagttgccgtccttgctgctgtcaatgacatcaacaatgattcgaatatccttccgggaacaaagctggatcttcatatgcatgattccagttgcaatcgctttcttggcattgtgcaaggtaatccattcgtgctttttctgccactgagtcaagcggacttatgttaccacatggtataaaacataactagtttcttcttcttctttgcatttgtcagccttgcaattcatggagaaagatacagtggcaatcatcggcccattgtcttctaccaccgcccatgtcctttctcatcttgcaaatgaactccacgtacctctgatgtccttttctgcaactgatccaactctttcgtcacttgagtatccgttctttgtgcggactaccgtcagtgatcaatttcaaatgactgctgttgctgacttagttgagtattatgggtggaagcaagtgacaaccatatttgtggataatgattatggaagaaatgcaatatcctctttaggcgatgaactttccaagaggcgatctaagatcctgtataaagctccatttaggccaggagcaagcaacaatgaaatagctgatgtgctgatcaaggttgcaatgatggagtctcgggtcatcatcctgcatgcgaatcccgactctggacttgtggttttccaacaagcactcaaacttggcatggtatccaatgggtatgcgtggattgcaacagattggctcacttcataccttgatccatcggtacatctcgacattggattactgagcacaatgcagggtgttcttacattgcgtcaccacactgaaaataccagaaggaagagtatgttgtcttcaaaatggagtgaattgcttaaggaggatagtggtcacagcagattcttgcttagtacttatggcctgtatgcttatgatactgtctggatgcttgctcatgcgctggatgcatttttcaatagtggcggaaacatttctttctctcctgaccccaaactaaatgaaatttcaggaagagggttgaatttggaagcattgagtgtctttgacggcggacagctgctactagaaaaaatccaccaggtagacttcttgggtgcaactggcccagtaaaatttgattcaggtggtaatcttatccagcctgcatatgacattgtcagcataataggatctggtttgcggacagttggttactggtccaactattctgggctatcagttatatctcctgagactctctacaagaaaccagcaaatcgtactagagaaactcaaaaacttcatgatgtgatctggccaggtgagactataaataagcctcggggatgggtttttcctaacaatggaaatgagataaagattggagttcccgatagggtaagttaccgtcaatttgtatcagttgatagtgaaactggaatggtgcggggactctgtattgatgtgtttgtcgctgcaataaacttgttagcatatccagttccgtataggtttgtaccttttgggaacaacagggagaatccaagctattcggagcttatcaataaaattataacagatgtaagtcctaattctgaaacttgcatcatgcttatcagcttatgattgattggtttatgtgtatctttcatggctaggactttgatgctgtggtaggcgatgtaactatcatcacaaatcgaacaaaggttgttgatttcactcagccatatgtgtcgtctgggcttgtggtccttacctctgttaagaggcagaactcgggtggatgggcctttctgcagccattcacgatcaagatgtggaccgtcactggactgttctttcttatcatagggacagtagtttggatgcttgaacatagaatcaatgatgaattccgtggccctcctgcgaaacagcttattactgtgttctggtaaggctataatttcgtcagtttgtatttatcgcgtgtacaattcctgcaaatatcattccatgttttctgtcaccattatccagattcttggacgatgaactggttttatttgcctgacacttcatgttctacttactttgcaggttcagtttctcaactctgtttttcgcacacagtgagtgaaacgacagcttgtcacattctcgacattttcaataaccatgatggaattttccagctcataggagctactctttcttctatgtttatacaggagaggacaccaggagcactctcggccgcttcgtgatcatcatatggctgttcgtcgttctgatcatccagtcgagctacactgccagcctgacctccatactcaccgtgcagcagctcacgtcgccgatcaccgggatcgacagcttgatcaccagcgacgttcccatcgggtttcaggtcgggtccttcgcggagaactacctcgcccaggagctcggcgttgcccactcgaggcttaaggcgctcggctcaccagaggagtacaagaaggcacttgaccttggccccagcaaaggaggcgttgcggccatcgtcgacgagcgcccgtacattgagctcttcttgtatcagaaccctaagttcgccgtcgtgggctccgagttcaccaagagcggctggggcttcgtgagttctcctcttttttctctcacagtttgacagtgggagatggattatctaattcaggggacatctatcttttcttacatttttcttacatgtcaactaaataaccattaagtttttttaaaaaaattaacaacatgcatggttaaatttgatcacttcaagttcaaaaaaaacaaattaaactaaaaatagttaacatacttgcaattataattgttatcgttcgtagttatacttgttattttattattatttttttagataagtttgttattttattataacttgtagaggttgaatttacacttgcattattctatagtgatatgttttataaatctatattattaaaaaaatatttttttataactatttagatggtatgcaagaaatgattgatatcttcggggagatgaaaacactttccttttgatagtgagttccatgcttttttttttctcatctcatgcaaaacgtgtgtacgattattgttaggcgttcccgagggactcgccgctgtcagtggacctgtcgacggcgatcctggagctgtcggagaacggcgacctgcagaggatccacgacaagtggctggcgagcgacatgtcgtccatgtcgcaggccagcgagctggatcaggatccggaccggctggacgtgtacagcttctcggcgctgttcctcatctgcggcctcgcctgcatcttcgccctcgccatacacgcctgcaacctcttctaccagtactcccgccacgccgcggaggaggaccccgctgcgctgcagccgtccgccagcgacggcagccgctccctctcccggcgcagcaagctccagtccttcctgtccttcgccgaccgccgggaagccgacatccggagggcggccaaggagaaggcgtctggtctgggcggcagcggagggtccatgagcggcgtcagcttcacgtcaagcggcagcggcagcaccaccgcttcatgctaaagccttgataattagttaattttcaggttaattactttacctctccttgtgctgcagaattgtagagatacgtaagcacattggaacttttgctgcgctccggcgcttactgaaacactagtatagcaatatactgaaacacattggagtaacattttgatcgactaaaacggcacgacctactatgatc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060211.1 RefSeq:Os04g0585200]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
GLR3.1, a Glu receptor–like gene, serves an important function in maintaining normal cell division activity and cell survival during rice seedling root development. The deduced amino acid sequence indicates that the GLR3.1 gene encodes a typical Glu receptor–like protein with close sequence and structural similarities to animal iGluRs. The extracellular
and cytoplasmic segments of iGluRs are thought to be available for ligand recognition, cytoplasmic modification, or interactions between the receptor and cytoplasmic proteins. The channel pore, which is formed by three membrane-spanning domains and one reentrant membrane loop, defines channel properties such as ion selectivity, permeability, and conductance. In the channel pore, the M2 loop is the structural basis for the ion selectivity filter. The identification of a distinctive exon–intron structure, which was found in the kainite subgroup of iGluRs and in clade III plant GLRs, indicates that the structure of the M2 loop might have emerged before the divergence of animals and plants.
Expression
Please input expression information here.
It expresses in root at a very low concentration, by using RT-PCR method can detect its expression.
Evolution
Alignment analysis showed a high similarity between rice GLR3.1 and 20 members of the Arabidopsis GLR family, especially in the M3 transmembrane domain (Figure 1). In the rice GLR3.1 protein sequence, we have identified all of the 37 invariant amino acid residues that are absolutely conserved in the Arabidopsis GLR family. Phylogenetic analysis of rice GLR3.1 with the entire GLR familyfrom Arabidopsis and the entire iGluR family from rat indicates that GLR3.1 is evolutionarily close to the clade III Arabidopsis GLRs.
'figure1 :Phylogenetic Tree Generated from Parsimony Analysis of Amino Acid Sequences of Rat iGluRs, Arabidopsis GLRs, and Rice GLR3.1 with synGluR0 as the Outgroup. Rice GLR3.1 marked by the asterisk. The numbers at the nodes are bootstrap values. Rice GLR3.1 was most similar to clade III of the GLRs. AMPA, a-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid; KA, kainate; NMDA, N-methyl-D-aspartate.
Labs working on this gene
1 State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310029, China
2 National Institute of Biological Sciences, Zhongguancun Life Science Park, Beijing 102206, China
3 Department of Molecular, Cellular, and Developmental Biology, Yale University, New Haven, Connecticut 06520-8104
References
Li J, Zhu S, Song X, et al. A rice glutamate receptor–like gene is critical for the division and survival of individual cells in the root apical meristem[J]. The Plant Cell Online, 2006, 18(2): 340-349.
Structured Information