Difference between revisions of "Os04g0619300"

From RiceWiki
Jump to: navigation, search
(References)
(Structured Information)
 
(41 intermediate revisions by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
''Ctb1'' is one of the quantitative trait loci (QTLs) for cold tolerance in the introgression on chromosome 4 of rice.
  
 
==Annotated Information==
 
==Annotated Information==
 +
 
===Function===
 
===Function===
Low temperatures during the booting stage reduce rice yields by causing cold-induced male sterility[1]. Ctb1 is a QTL for cold tolerance, which is located in the introgression on chromosome 4[2]. Researches mapped Ctb1 to a 17-kb region containing two genes that encode an F-box protein and a ser/thr protein kinase. Both genes were cloned from a cold-tolerant variety, Norin-PL8, and introduced into a cold-sensitive variety, Hokkai241, and a cold-sensitive line, BT4-74-8. The cold tolerance of T2 and T3 progenies was assessed by measuring the degree of spikelet fertility in plants treated with cool water irrigation (19◦C, 25 cm) or cool air (12◦C, 4 days).
+
Low temperatures during the booting stage reduce rice yields by causing cold-induced male sterility<ref name="ref1">K. Saito, Y. Hayano-Saito, M. Kuroki, Y. Sato,(2010) Map-based cloning of the rice cold tolerance gene ''Ctb1'', Plant Science, 179:97–102.</ref>. ''Ctb1'' is a QTL for cold tolerance, which is located in the introgression on chromosome 4<ref name="ref2">K. Saito, K. Miura, K. Nagano, Y. Hayano-Saito, H. Araki, A. Kato, (2001) Identification of two closely linked quantitative trait loci for cold tolerance on chromosome 4 of rice and their association with anther length, Theor. Appl. Genet. 103: 862–868.</ref>. Researches mapped ''Ctb1'' to a 17-kb region containing two genes that encode an F-box protein and a ser/thr protein kinase. Both genes were cloned from a cold-tolerant variety, Norin-PL8, and introduced into a cold-sensitive variety, Hokkai241, and a cold-sensitive line, BT4-74-8. The cold tolerance of T2 and T3 progenies was assessed by measuring the degree of spikelet fertility in plants treated with cool water irrigation (19◦C, 25 cm) or cool air (12◦C, 4 days).
The results indicated that the F-box protein gene confers cold tolerance. Cold tolerance is associated with greater anther length, which is one of major factors in cold tolerance at the booting stage. Ctb-1 expressed cold tolerance by producing a large anther. The transgenic plants had longer anthers than non-transformed controls. The F-box protein encoded by Ctb1 interact with a subunit of the E3 ubiquitin ligase, Skp1, suggesting that an ubiquitin–proteasome pathway is involved in cold tolerance at the booting stage[1].
 
  
[[File:Anther.JPG]]
 
  
Table. 1 Cold tolerance, heading date and anther length of the near-isogenic lines(NILs) and parental varieties[2]
+
[[File:Anther.JPG|left|thumb|600px|''Table. 1 Cold tolerance, heading date and anther length of the near-isogenic lines(NILs) and parental varieties (from reference  <ref name="ref2" />).'']][[File:Seed.JPG|center|thumb|450px|''Fig. 1. Relation between cold tolerance and anther length shown in Table 1. Circles represent the NILs: open circles represent the NILs without either Ctb-1or Ctb-2, and closed circles represent the NILs with Ctb-1and/or Ctb-2. Open and closed triangles represent Kirara397 and Norin-PL8, respectively (from reference  <ref name="ref2" />).'']]
  
[[File:Seed.JPG]]
 
  
Fig. 1. Relation between cold tolerance and anther length shown in Table 1. Circles represent the NILs: open circles represent the NILs without either Ctb-1or Ctb-2, and closed circles represent the NILs with Ctb-1and/or Ctb-2. Open and closed triangles represent Kirara397 and Norin-PL8, respectively[2]
 
  
'''GO assignment(s)''':  GO:0003674  GO:0005634   GO:0008150
+
The results indicated that the F-box protein gene confers cold tolerance. Cold tolerance is associated with greater anther length, which is one of major factors in cold tolerance at the booting stage. Ctb-1 expressed cold tolerance by producing a large anther. The transgenic plants had longer anthers than non-transformed controls. The F-box protein encoded by ''Ctb1'' interact with a subunit of the E3 ubiquitin ligase, Skp1, suggesting that an ubiquitin–proteasome pathway is involved in cold tolerance at the booting stage<ref name="ref1">K. Saito, Y. Hayano-Saito, M. Kuroki, Y. Sato,(2010) Map-based cloning of the rice cold tolerance gene ''Ctb1'', Plant Science, 179:97–102.</ref>.
 +
 
 +
 
 +
'''GO assignment(s)''':  GO:[http://amigo.geneontology.org/amigo/term/GO:0003674 0003674]   GO:[http://amigo.geneontology.org/amigo/term/GO:0005634 0005634]  GO:[http://amigo.geneontology.org/amigo/term/GO:0008150 0008150]
  
 
===Expression===
 
===Expression===
[[File:PCR.JPG]]
 
  
Fig. 2 RT-PCR and structural analysis of the Ctb1 candidate genes. (a) Expression of genes encoding F-box protein (FB) and a ser/thr protein kinase(PK) in mature leaves (L) and young panicles (YP) from a cold sensitive variety Kirara397 (K) and a cold-tolerant variety Norin-PL8 (N). ACTIN gene was used as a reference. (b) Diagrams of DNA fragments containing the FB and PK genes cloned from Norin-PL8 genomic DNA. Black rectangles, black triangles, and open triangles indicate putative exons, initiation codons, and stop codons, respectively<nowiki>[1]</nowiki>.
+
[[File:PCR.JPG|center|thumb|450px|''Fig. 2 RT-PCR and structural analysis of the ''Ctb1'' candidate genes. (a) Expression of genes encoding F-box protein (FB) and a ser/thr protein kinase(PK) in mature leaves (L) and young panicles (YP) from a cold sensitive variety Kirara397 (K) and a cold-tolerant variety Norin-PL8 (N). ACTIN gene was used as a reference. (b) Diagrams of DNA fragments containing the FB and PK genes cloned from Norin-PL8 genomic DNA. Black rectangles, black triangles, and open triangles indicate putative exons, initiation codons, and stop codons, respectively (from reference  <ref name="ref1" />).'']]
 +
 
 +
 
 +
Sequence analyses indicated no polymorphism between Norin-PL8 and Kirara397 in the coding regions but several polymorphisms (mostly single nucleotide polymorphisms) in the 5’ upstream regions of both F-box protein (FB) and a ser/thr protein kinase(PK). Comparing the expression of the genes in Norin-PL8 and Kirara397 by RT-PCR analysis, PK was expressed in mature leaves and young panicles. By contrast, FB was expressed preferentially in young panicles, suggesting that FB was a more likely candidate to be ''Ctb1''. No differences were observed in expression levels between Norin-PL8 and Kirara397<ref name="ref1">K. Saito, Y. Hayano-Saito, M. Kuroki, Y. Sato,(2010) Map-based cloning of the rice cold tolerance gene ''Ctb1'', Plant Science, 179:97–102.</ref>.
 +
 
 +
===Evolution===
 +
 
 +
K.Saito et al<ref name="ref2">K. Saito, K. Miura, K. Nagano, Y. Hayano-Saito, H. Araki, A. Kato, (2001) Identification of two closely linked quantitative trait loci for cold tolerance on chromosome 4 of rice and their association with anther length, Theor. Appl. Genet. 103: 862–868.</ref> concluded that there are at least two QTLs for cold tolerance in the introgression on chromosome 4 of rice, and tentatively designated as Ctb-1 and Ctb-2.
  
Sequence analyses indicated no polymorphism between Norin-PL8 and Kirara397 in the coding regions but several polymorphisms (mostly single nucleotide polymorphisms) in the 5’ upstream regions of both F-box protein (FB) and a ser/thr protein kinase(PK). Comparing the expression of the genes in Norin-PL8 and Kirara397 by RT-PCR analysis, PK was expressed in mature leaves and young panicles. By contrast, FB was expressed preferentially in young panicles, suggesting that FB was a more likely candidate to be Ctb1. No differences were observed in expression levels between Norin-PL8 and Kirara397[1].
 
  
 
===Knowledge Extension===
 
===Knowledge Extension===
Rice is a staple crop cultivated worldwide. However, since it is a cold-sensitive plant that evolved in tropical and subtropical areas, rice yields are greatly reduced under low temperature conditions. One of the factors reducing rice yields is cold-induced male sterility (CIMS). In CIMS, the growth stage that is sensitive to cold is the booting stage, especially the young microspore stage just after meiosis[3]. Low temperatures at the young microspore stage cause the degeneration of microspores and hypertrophy of tapetal cells[4].
 
  
===Evolution===
+
Rice is a staple crop cultivated worldwide. However, since it is a cold-sensitive plant that evolved in tropical and subtropical areas, rice yields are greatly reduced under low temperature conditions. One of the factors reducing rice yields is cold-induced male sterility (CIMS). In CIMS, the growth stage that is sensitive to cold is the booting stage, especially the young microspore stage just after meiosis<ref name="ref3">T. Satake, H. Hayase, (1970) Male sterility caused by cooling treatment at the young microspore stage in rice plants, V. Estimation of pollen developmental stage and the most sensitive stage to coolness, Proc. Crop Sci. Soc. Jpn. 39: 468–473.</ref>. Low temperatures at the young microspore stage cause the degeneration of microspores and hypertrophy of tapetal cells<ref name="ref4">I. Nishiyama, (1976) Male sterility caused by cooling treatment at the young microspore stage in rice plants, XIII. Ultrastructure of tapetal hypertrophy without primary wall, Proc. Crop Sci. Soc. Jpn. 45:270–278.</ref>.
K.Saito et al[2] concluded that there are at least two QTLs for cold tolerance in the introgression on chromosome 4 of rice, and tentatively designated as Ctb-1 and Ctb-2.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
  
Natl Agr Res Ctr Hokkaido Reg, Hitsujigaoka 1, Sapporo, Hokkaido 0628555, Japan
+
*Natl Agr Res Ctr Hokkaido Reg, Hitsujigaoka 1, Sapporo, Hokkaido 0628555, Japan
  
Univ Florida, IFAS, Ctr Citrus Res & Educ, Lake Alfred, FL 33850 USA
+
*Univ Florida, IFAS, Ctr Citrus Res & Educ, Lake Alfred, FL 33850 USA
  
N Carolina State Univ, Dept Bot, Raleigh, NC 27695 USA
+
*N Carolina State Univ, Dept Bot, Raleigh, NC 27695 USA
  
 
==References==
 
==References==
Line 41: Line 44:
 
<references>
 
<references>
  
<ref>K. Saito, Y. Hayano-Saito, M. Kuroki, Y. Sato,(2010) Map-based cloning of the rice cold tolerance gene Ctb1, Plant Science, 179:97–102.</ref>
+
<ref name="ref1">K. Saito, Y. Hayano-Saito, M. Kuroki, Y. Sato,(2010) Map-based cloning of the rice cold tolerance gene ''Ctb1'', Plant Science, 179:97–102.</ref>
  
 
<ref name="ref2">K. Saito, K. Miura, K. Nagano, Y. Hayano-Saito, H. Araki, A. Kato, (2001) Identification of two closely linked quantitative trait loci for cold tolerance on chromosome 4 of rice and their association with anther length, Theor. Appl. Genet. 103: 862–868.</ref>
 
<ref name="ref2">K. Saito, K. Miura, K. Nagano, Y. Hayano-Saito, H. Araki, A. Kato, (2001) Identification of two closely linked quantitative trait loci for cold tolerance on chromosome 4 of rice and their association with anther length, Theor. Appl. Genet. 103: 862–868.</ref>
Line 52: Line 55:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0619300|
 
Description = Cyclin-like F-box domain containing protein|
 
Version = NM_001060432.1 GI:115460593 GeneID:4337020|
 
Length = 3063 bp|
 
Definition = Oryza sativa Japonica Group Os04g0619300, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:31857495..31860557|
 
CDS = 31858937..31860304|
 
GCID = <gbrowseImage1>
 
name=NC_008397:31857495..31860557
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:31857495..31860557
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggaagatttacaagattgtgactgcaaaagccttgttgctgttcctggttctgtggttctgcacctctttaggctgtttaatcagcaggataattcctggcagaagtacacattagcctactttcttttggtcaggaatgagtacttctctagggattcaaggaagcattcagatgggaagaaccaacttcttgactgctgtgatgattcagaattagatttggatgtgctgtatgctgatttggatagtaaagaactggagcttaagttgcagaaacctgttgtcaagactcaatcaaaaggtgactcaagtgccagtggatcaaatgattgcttctttcctggccttcacgacgacctggctcaggactgccttgcttgggcgagcagatcagactacccatcgctttcttgtttgaataagaagttcaatttgttaatcaacagcgggtatctgtacagactgagaagaaaatatggcattgttgaacactgggtgtatctagcgtgtagcttgatgccctgggaagcatttgatccttcacgcaagcgatggatgaggctcccaagaatgccatgcgacgagtgcttctcttgtgcagacaaggaatcgcttgccgtcgggacacaactgcttgtgtttggccgtgaatatacaggtcttgctatttggatgtacaatttactggcccgtggttggtcccgatgcactccaatgaacctgcctcgctgcctctttgcctcaggaagctttggtgagattgctattgttgctggtgggtgtgataagaatggacaggtgctgaaatctgccgagctgtacaattcagagactggtcattgggagactttgccagacatgaacttgccgaggaggctctcatctggtttcttcatggatggaaagttttatgtcattgggggtgtgtcaagtcagagggattctttgacttgtggagaggaatacaatcttgaaacaaggacatggagaagaatacatgatatgtaccctggagggactagtgcctctcaatctcctcccctagttgctgttgtgaataatcagctttatgcagctgatcaggcaacaaatgtggtaaagaagtacgacaaaggaaataacacctggaacatagtgaagccattgccagtcagagctgactcttccaatggttggggcctagctttcaaggcatgtggtgatagattgcttgttattggtggccatagagtaccccgtggtgaagtaatattgctgcattcttggtgccctgaagatgggaatggtggtgctgactgggaagtgctctcggtgaaggagcgtgctggtgtattcgtttataactgcgcaataatggggtgctga</cdnaseq>|
 
AA = <aaseq>MEDLQDCDCKSLVAVPGSVVLHLFRLFNQQDNSWQKYTLAYFLL                    VRNEYFSRDSRKHSDGKNQLLDCCDDSELDLDVLYADLDSKELELKLQKPVVKTQSKG                    DSSASGSNDCFFPGLHDDLAQDCLAWASRSDYPSLSCLNKKFNLLINSGYLYRLRRKY                    GIVEHWVYLACSLMPWEAFDPSRKRWMRLPRMPCDECFSCADKESLAVGTQLLVFGRE                    YTGLAIWMYNLLARGWSRCTPMNLPRCLFASGSFGEIAIVAGGCDKNGQVLKSAELYN                    SETGHWETLPDMNLPRRLSSGFFMDGKFYVIGGVSSQRDSLTCGEEYNLETRTWRRIH                    DMYPGGTSASQSPPLVAVVNNQLYAADQATNVVKKYDKGNNTWNIVKPLPVRADSSNG                    WGLAFKACGDRLLVIGGHRVPRGEVILLHSWCPEDGNGGADWEVLSVKERAGVFVYNC                    AIMGC</aaseq>|
 
DNA = <dnaseqindica>1443..2810#gctctccatgccctccccgtctcactgacggtggtcccaccgccccacgctccccccccgtgggccccgttcgtcggcgaccgaccgctagctccggcgaccccctccccgccgacgagatccggccgtctccggtgagctccccccccccactctctctcctccccggcgcgcggcgcgttgtcccacgagaaacccgcgtaaccgctctcctctcttgcttccttgtggcccgtgcgccaacgcgcaggttttcttggagccgctcgtcgtggctggggtggcgccggggggaatggaggcggccggcgctcgcgcgggcggtggcggccgggatctcgccggcggcgcgcctcggtgaggtcaggatgtggctcaattctctcgtttggttgcgaaggtctttctgttctttttttctctctttttgtttggtgagtgcttgagctgaagtcgtggctcgtagatttagaggaaagttaattctgttttgttgtgagttagtggttggtgaattagttggggaaaacgtctgcattttttttctgtttggttcagagcgagaaaaattcgagatttttggagagctttgtgtcatggagagcagcaaccagatgtggccgtttcttttgcttgcggatgtttctttttttttgggtgagaatagagaggtttttttgcttgcattctgcaaatcttggggttattttctgttttgctggattttcctttttgttaggatagataattagttgtcgtcttccgtgtgaattggtcaggtcagatagccaccttagaggttatttttttcttgtgttgaatccaaatctagaactagcagatgatagtagtaatgtactagccggtgctttggtacaaagtctaattattcctctgttttagatgaaacttgatggtagaaatgttttggatataatttgtttcttgaggcaaatgcttttttggatcaagttggctaagaagcagaaaccagtttggatgcccaggctagcagaatcagccatgtaggcaaatatttttttgttggtatcaacaataaaaaatgattgcatatgattactaacggaagatttggaatcgttggtcttagtggtacaaaattttagttgtttacttgattctgaatacgccaaagctgggggaaatatatatttttccatcaaatcaactctgaagatttttttagtgaaataaatgtacctattaagacgaacatgcctagatgagtccattgtttaactctgtagtggtatctgagctaaaattatgtatattgtttgctctgttcttgatccagaaatttagtgcatttcaaatacgctgtgctcattttgctatttatctcaaaatattttccagatgtgatctgtgatctgtccaacctttgtgtactcgggctcattccacagttaacaaaaaagatggaagatttacaagattgtgactgcaaaagccttgttgctgttcctggttctgtggttctgcacctctttaggctgtttaatcagcaggataattcctggcagaagtacacattagcctactttcttttggtcaggaatgagtacttctctagggattcaaggaagcattcagatgggaagaaccaacttcttgactgctgtgatgattcagaattagatttggatgtgctgtatgctgatttggatagtaaagaactggagcttaagttgcagaaacctgttgtcaagactcaatcaaaaggtgactcaagtgccagtggatcaaatgattgcttctttcctggccttcacgacgacctggctcaggactgccttgcttgggcgagcagatcagactacccatcgctttcttgtttgaataagaagttcaatttgttaatcaacagcgggtatctgtacagactgagaagaaaatatggcattgttgaacactgggtgtatctagcgtgtagcttgatgccctgggaagcatttgatccttcacgcaagcgatggatgaggctcccaagaatgccatgcgacgagtgcttctcttgtgcagacaaggaatcgcttgccgtcgggacacaactgcttgtgtttggccgtgaatatacaggtcttgctatttggatgtacaatttactggcccgtggttggtcccgatgcactccaatgaacctgcctcgctgcctctttgcctcaggaagctttggtgagattgctattgttgctggtgggtgtgataagaatggacaggtgctgaaatctgccgagctgtacaattcagagactggtcattgggagactttgccagacatgaacttgccgaggaggctctcatctggtttcttcatggatggaaagttttatgtcattgggggtgtgtcaagtcagagggattctttgacttgtggagaggaatacaatcttgaaacaaggacatggagaagaatacatgatatgtaccctggagggactagtgcctctcaatctcctcccctagttgctgttgtgaataatcagctttatgcagctgatcaggcaacaaatgtggtaaagaagtacgacaaaggaaataacacctggaacatagtgaagccattgccagtcagagctgactcttccaatggttggggcctagctttcaaggcatgtggtgatagattgcttgttattggtggccatagagtaccccgtggtgaagtaatattgctgcattcttggtgccctgaagatgggaatggtggtgctgactgggaagtgctctcggtgaaggagcgtgctggtgtattcgtttataactgcgcaataatggggtgctgaattacatttctttcggtataatccgtatatgcctcttgtttagcaacccacccatttcttgctgctgcttagctaccccctataatgacctgtaattcagaaaaatgacaccccccttttcgtggagctctcaatgaaatgtttgggagagagcatagagcattcagttcagtttacctggaacttcttttaactcgttcaaaatttgttcttcttgtccagtatgaaatttatgcagtattctttattcatc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060432.1 RefSeq:Os04g0619300]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:12, 12 June 2015

Ctb1 is one of the quantitative trait loci (QTLs) for cold tolerance in the introgression on chromosome 4 of rice.

Annotated Information

Function

Low temperatures during the booting stage reduce rice yields by causing cold-induced male sterility[1]. Ctb1 is a QTL for cold tolerance, which is located in the introgression on chromosome 4[2]. Researches mapped Ctb1 to a 17-kb region containing two genes that encode an F-box protein and a ser/thr protein kinase. Both genes were cloned from a cold-tolerant variety, Norin-PL8, and introduced into a cold-sensitive variety, Hokkai241, and a cold-sensitive line, BT4-74-8. The cold tolerance of T2 and T3 progenies was assessed by measuring the degree of spikelet fertility in plants treated with cool water irrigation (19◦C, 25 cm) or cool air (12◦C, 4 days).


Table. 1 Cold tolerance, heading date and anther length of the near-isogenic lines(NILs) and parental varieties (from reference [2]).
Fig. 1. Relation between cold tolerance and anther length shown in Table 1. Circles represent the NILs: open circles represent the NILs without either Ctb-1or Ctb-2, and closed circles represent the NILs with Ctb-1and/or Ctb-2. Open and closed triangles represent Kirara397 and Norin-PL8, respectively (from reference [2]).


The results indicated that the F-box protein gene confers cold tolerance. Cold tolerance is associated with greater anther length, which is one of major factors in cold tolerance at the booting stage. Ctb-1 expressed cold tolerance by producing a large anther. The transgenic plants had longer anthers than non-transformed controls. The F-box protein encoded by Ctb1 interact with a subunit of the E3 ubiquitin ligase, Skp1, suggesting that an ubiquitin–proteasome pathway is involved in cold tolerance at the booting stage[1].


GO assignment(s): GO:0003674 GO:0005634 GO:0008150

Expression

Fig. 2 RT-PCR and structural analysis of the Ctb1 candidate genes. (a) Expression of genes encoding F-box protein (FB) and a ser/thr protein kinase(PK) in mature leaves (L) and young panicles (YP) from a cold sensitive variety Kirara397 (K) and a cold-tolerant variety Norin-PL8 (N). ACTIN gene was used as a reference. (b) Diagrams of DNA fragments containing the FB and PK genes cloned from Norin-PL8 genomic DNA. Black rectangles, black triangles, and open triangles indicate putative exons, initiation codons, and stop codons, respectively (from reference [1]).


Sequence analyses indicated no polymorphism between Norin-PL8 and Kirara397 in the coding regions but several polymorphisms (mostly single nucleotide polymorphisms) in the 5’ upstream regions of both F-box protein (FB) and a ser/thr protein kinase(PK). Comparing the expression of the genes in Norin-PL8 and Kirara397 by RT-PCR analysis, PK was expressed in mature leaves and young panicles. By contrast, FB was expressed preferentially in young panicles, suggesting that FB was a more likely candidate to be Ctb1. No differences were observed in expression levels between Norin-PL8 and Kirara397[1].

Evolution

K.Saito et al[2] concluded that there are at least two QTLs for cold tolerance in the introgression on chromosome 4 of rice, and tentatively designated as Ctb-1 and Ctb-2.


Knowledge Extension

Rice is a staple crop cultivated worldwide. However, since it is a cold-sensitive plant that evolved in tropical and subtropical areas, rice yields are greatly reduced under low temperature conditions. One of the factors reducing rice yields is cold-induced male sterility (CIMS). In CIMS, the growth stage that is sensitive to cold is the booting stage, especially the young microspore stage just after meiosis[3]. Low temperatures at the young microspore stage cause the degeneration of microspores and hypertrophy of tapetal cells[4].

Labs working on this gene

  • Natl Agr Res Ctr Hokkaido Reg, Hitsujigaoka 1, Sapporo, Hokkaido 0628555, Japan
  • Univ Florida, IFAS, Ctr Citrus Res & Educ, Lake Alfred, FL 33850 USA
  • N Carolina State Univ, Dept Bot, Raleigh, NC 27695 USA

References

  1. 1.0 1.1 1.2 1.3 K. Saito, Y. Hayano-Saito, M. Kuroki, Y. Sato,(2010) Map-based cloning of the rice cold tolerance gene Ctb1, Plant Science, 179:97–102.
  2. 2.0 2.1 2.2 2.3 K. Saito, K. Miura, K. Nagano, Y. Hayano-Saito, H. Araki, A. Kato, (2001) Identification of two closely linked quantitative trait loci for cold tolerance on chromosome 4 of rice and their association with anther length, Theor. Appl. Genet. 103: 862–868.
  3. T. Satake, H. Hayase, (1970) Male sterility caused by cooling treatment at the young microspore stage in rice plants, V. Estimation of pollen developmental stage and the most sensitive stage to coolness, Proc. Crop Sci. Soc. Jpn. 39: 468–473.
  4. I. Nishiyama, (1976) Male sterility caused by cooling treatment at the young microspore stage in rice plants, XIII. Ultrastructure of tapetal hypertrophy without primary wall, Proc. Crop Sci. Soc. Jpn. 45:270–278.

Structured Information