Difference between revisions of "Os04g0690800"

From RiceWiki
Jump to: navigation, search
(References)
(Structured Information)
 
(9 intermediate revisions by one other user not shown)
Line 2: Line 2:
  
 
==Function==
 
==Function==
PsbS is associated with the reversible de-epoxidation of violaxanthin to
+
PsbS is associated with the reversible de-epoxidation of violaxanthin to zeaxanthin, the so-called xanthophyll cycle<ref name="ref1">Satoshi Ishida[1,4], Ken-ichi Morita[1,4], Masahiro Kishine[1], Atsushi Takabayashi[1], Reiko Murakami[1],Satomi Takeda[2], Ko Shimamoto[3], FumihikoSat[1]  and Tsuyoshi Endo[1].Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice[J]. Cell Physiol (2011), 52 (10): 1822-1831.</ref>.
zeaxanthin, the so-called xanthophyll cycle.
+
 
 +
PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit<ref name="ref1">Satoshi Ishida[1,4], Ken-ichi Morita[1,4], Masahiro Kishine[1], Atsushi Takabayashi[1], Reiko Murakami[1],Satomi Takeda[2], Ko Shimamoto[3], FumihikoSat[1]  and Tsuyoshi Endo[1].Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice[J]. Cell Physiol (2011), 52 (10): 1822-1831.</ref>.
  
PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit.
 
 
==Expression==
 
==Expression==
To confirm the RNAi effect, the expression ofpsbS genes in T2 transgenic rice was analyzed (Fig. 1A). Quantitative reverse transcription–PCR (RT–PCR) analysis revealed that the amounts of bothpsbS1 andpsbS2 transcripts were significantly reduced in the �1&2-1 and �1&2-2 lines. On the other hand,psbS gene expression in the�2 line was not distinguishable from that in the wild type, suggesting that gene silencing of psbS2 in the�2 line did not work. Immunoblot analysis using anti-PsbS antibody showed that the accumulation of PsbS protein was not detected in the �1&2-1 and �1&2-2 lines(Fig. 1B). Two isoproteins derived from each of the homolog genes could not be distinguished by SDS–PAGE analysis. These results indicate that the expression of psbS genes in the� 1&2-1 and� 1&2-2 lines was successfully silenced by RNAi.[[File:Expression of psbS genes in transgenic plants.png]]
+
To confirm the RNAi effect, the expression ofpsbS genes in T2 transgenic rice was analyzed (Fig. 1A). Quantitative reverse transcription–PCR (RT–PCR) analysis revealed that the amounts of bothpsbS1 andpsbS2 transcripts were significantly reduced in the �1&2-1 and �1&2-2 lines. On the other hand,psbS gene expression in the�2 line was not distinguishable from that in the wild type, suggesting that gene silencing of psbS2 in the�2 line did not work. Immunoblot analysis using anti-PsbS antibody showed that the accumulation of PsbS protein was not detected in the �1&2-1 and �1&2-2 lines(Fig. 1B). Two isoproteins derived from each of the homolog genes could not be distinguished by SDS–PAGE analysis. These results indicate that the expression of psbS genes in the� 1&2-1 and� 1&2-2 lines was successfully silenced by RNAi[1].[[File:Expression of psbS genes in transgenic plants.png]]
 
 
===Evolution===
 
Please input evolution information here.
 
  
You can also add sub-section(s) at will.
+
===sequence===
 +
Two psbS genes were found in the rice genome by BLASTN in the NCBI database based
 +
on the sequence of psbSofArabidopsis thaliana. PsbS2 is located on chromosome.The number of registered expressed sequence tags (ESTs) in leaves (total ESTs, 171,890) of psbS1 was 50, while that of psbS2 was six based on the NCBI UniGene database (http://www.ncbi.nlm.nih.gov/unigene),suggesting that psbS1 is expressed more than psbS2.Phylogenetic analysis showed that PsbS1 had high sequence homology with proteins from other Gramineae plants, while PsbS2 rather resembled proteins from dicot species
 +
,although the bootstrap values are too low to draw any unambiguous conclusions regarding the rather unexpected position of psbS2.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 20: Line 20:
  
 
==References==
 
==References==
Satoshi Ishida1,4, Ken-ichi Morita1,4, Masahiro Kishine1, Atsushi Takabayashi1, Reiko Murakami1,Satomi Takeda2, Ko Shimamoto3, FumihikoSat1 and Tsuyoshi Endo1.Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice[J]. Cell Physiol (2011), 52 (10): 1822-1831.
+
Satoshi Ishida[1,4], Ken-ichi Morita[1,4], Masahiro Kishine[1], Atsushi Takabayashi[1], Reiko Murakami[1],Satomi Takeda[2], Ko Shimamoto[3], FumihikoSat[1] and Tsuyoshi Endo[1].Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice[J]. Cell Physiol (2011), 52 (10): 1822-1831.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os04g0690800|
 
Description = 22 kDa protein of photosystem II|
 
Version = NM_001060889.1 GI:115461507 GeneID:4337500|
 
Length = 1113 bp|
 
Definition = Oryza sativa Japonica Group Os04g0690800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
 
AP = Chromosome 4:35736923..35738035|
 
CDS = 35737068..35737832|
 
GCID = <gbrowseImage1>
 
name=NC_008397:35736923..35738035
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008397:35736923..35738035
 
source=RiceChromosome04
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctctgcagcagagcatggcgatgccgatgatggtagtgtctgaccttggcaccgctcctcggtcatcgccgatggttcagctgcagaggatgaagaagcatctggtggtggtggcggcgttcaagagcagaaccaaggcttcccccaaggtggacaagtcgaacaagaacaagtcgatcgtggaggacggcatcttcggcacctccggcggcatcgggttcaccaaggagaacgagctgttcgtggggagggtggccatgctggggttcgcggcgtccctcctcggcgaggcggtcaccggcaagggcatcctggcgcagctcaacctggagacgggcatccccatctacgaggccgagccgctgctcctcttcttcatcctcttcacgctgctgggcgccatcggcgcgctgggcgaccgggggcgcttcgtggacgacgccaccgggctggagcgcgccgtgatcccgccggggaaggggttccgcgcggcgctggggctcagcgagggtggcccgctgttcgggttcaccaaggcgaacgagctcttcgtgggtcgcctcgcgcagctggggatcgccttctccctcatcggcgagatcatcaccgggaagggcgcgctggcgcagctcaacatcgagaccggcgtccccatcaacgagatcgagccgctcctcctcttcaacatcctcttcttcttcttcgccgccatcaaccccggaaccggcaagttcgtcaccgacgacaacgacgaccaatga</cdnaseq>|
 
AA = <aaseq>MALQQSMAMPMMVVSDLGTAPRSSPMVQLQRMKKHLVVVAAFKS                    RTKASPKVDKSNKNKSIVEDGIFGTSGGIGFTKENELFVGRVAMLGFAASLLGEAVTG                    KGILAQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGRFVDDATGLERAVIPPG                    KGFRAALGLSEGGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGV                    PINEIEPLLLFNILFFFFAAINPGTGKFVTDDNDDQ</aaseq>|
 
DNA = <dnaseqindica>146..910#attccaagagagcaagccaagatcaagagatcgatcatatcgtattttgtagtaatttagcagctagctagtgcagctgcaagctattagcgactgcatgctttgatcgatccatctagctaattgttgaatccatctaagcttaatggctctgcagcagagcatggcgatgccgatgatggtagtgtctgaccttggcaccgctcctcggtcatcgccgatggttcagctgcagaggatgaagaagcatctggtggtggtggcggcgttcaagagcagaaccaaggcttcccccaaggtggacaagtcgaacaagaacaagtcgatcgtggaggacggcatcttcggcacctccggcggcatcgggttcaccaaggagaacgagctgttcgtggggagggtggccatgctggggttcgcggcgtccctcctcggcgaggcggtcaccggcaagggcatcctggcgcagctcaacctggagacgggcatccccatctacgaggccgagccgctgctcctcttcttcatcctcttcacgctgctgggcgccatcggcgcgctgggcgaccgggggcgcttcgtggacgacgccaccgggctggagcgcgccgtgatcccgccggggaaggggttccgcgcggcgctggggctcagcgagggtggcccgctgttcgggttcaccaaggcgaacgagctcttcgtgggtcgcctcgcgcagctggggatcgccttctccctcatcggcgagatcatcaccgggaagggcgcgctggcgcagctcaacatcgagaccggcgtccccatcaacgagatcgagccgctcctcctcttcaacatcctcttcttcttcttcgccgccatcaaccccggaaccggcaagttcgtcaccgacgacaacgacgaccaatgagcccagcccacccctcattttgcttttactccacttaattaaattagcttcttctgatagtagtaaggagacggttaagtggactagctagtcaatgtcaatcctctcctctgtactgtagtggagtagtatctacttatatgcatatactagcaaaaattcaggacacaacaatcaatcggtactcctgaatgcatgatggg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060889.1 RefSeq:Os04g0690800]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:21, 12 June 2015

Please input one-sentence summary here.

Function

PsbS is associated with the reversible de-epoxidation of violaxanthin to zeaxanthin, the so-called xanthophyll cycle[1].

PsbS regulates CO2 assimilation rate when light fluctuates. Its content has significant influence on the chloroplasts protective energy dissipation (chloroplastic protective energy dissipation, qE). Chl fluorescence as energy quenching(qE) depends on the presence of the PsbS subunit[1].

Expression

To confirm the RNAi effect, the expression ofpsbS genes in T2 transgenic rice was analyzed (Fig. 1A). Quantitative reverse transcription–PCR (RT–PCR) analysis revealed that the amounts of bothpsbS1 andpsbS2 transcripts were significantly reduced in the �1&2-1 and �1&2-2 lines. On the other hand,psbS gene expression in the�2 line was not distinguishable from that in the wild type, suggesting that gene silencing of psbS2 in the�2 line did not work. Immunoblot analysis using anti-PsbS antibody showed that the accumulation of PsbS protein was not detected in the �1&2-1 and �1&2-2 lines(Fig. 1B). Two isoproteins derived from each of the homolog genes could not be distinguished by SDS–PAGE analysis. These results indicate that the expression of psbS genes in the� 1&2-1 and� 1&2-2 lines was successfully silenced by RNAi[1].File:Expression of psbS genes in transgenic plants.png

sequence

Two psbS genes were found in the rice genome by BLASTN in the NCBI database based on the sequence of psbSofArabidopsis thaliana. PsbS2 is located on chromosome.The number of registered expressed sequence tags (ESTs) in leaves (total ESTs, 171,890) of psbS1 was 50, while that of psbS2 was six based on the NCBI UniGene database (http://www.ncbi.nlm.nih.gov/unigene),suggesting that psbS1 is expressed more than psbS2.Phylogenetic analysis showed that PsbS1 had high sequence homology with proteins from other Gramineae plants, while PsbS2 rather resembled proteins from dicot species ,although the bootstrap values are too low to draw any unambiguous conclusions regarding the rather unexpected position of psbS2.

Labs working on this gene

There are many labs working on PsbS.Demmig-Adams and Hendrickson both have their own models on this study. EST, expressed sequence tag; Fm(Fm0), themaximum fluorescence achieved with a saturating light pulse in the dark (or in the light);Fo (Fo0), the minimumfluorescence achieved under the measuring light in the dark(or in the light); Fs, steady-state fluorescence in the light; �D,the quantum rate of absorbed light energy in PSII allocated to Dissipationin the Demmig-Adams model; �E , the quantum rate of absorbed light energy in PSII allocated to Exess in the Demmig-Adams model; �f,D, the quantum yield of basic dissipation in the Hendrickson model;�NPQ, the quantum yield of light-inducible dissipation in the Hendrickson model.

References

Satoshi Ishida[1,4], Ken-ichi Morita[1,4], Masahiro Kishine[1], Atsushi Takabayashi[1], Reiko Murakami[1],Satomi Takeda[2], Ko Shimamoto[3], FumihikoSat[1] and Tsuyoshi Endo[1].Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice[J]. Cell Physiol (2011), 52 (10): 1822-1831.

Structured Information

  1. 1.0 1.1 Satoshi Ishida[1,4], Ken-ichi Morita[1,4], Masahiro Kishine[1], Atsushi Takabayashi[1], Reiko Murakami[1],Satomi Takeda[2], Ko Shimamoto[3], FumihikoSat[1] and Tsuyoshi Endo[1].Allocation of Absorbed Light Energy in PSII to Thermal Dissipations in the Presence or Absence of PsbS Subunits of Rice[J]. Cell Physiol (2011), 52 (10): 1822-1831.