Difference between revisions of "Os05g0100401"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os05g0100401| Description = Conserved hypothetical protein| Version = NM_001187234.1 GI:297723598 GeneID:9271261| Length = 2120 bp| Definition ...")
 
(Structured Information)
 
(4 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
Please input one-sentence summary here.
GeneName = Os05g0100401|
+
 
Description = Conserved hypothetical protein|
+
==Annotated Information==
Version = NM_001187234.1 GI:297723598 GeneID:9271261|
+
===Function===
Length = 2120 bp|
+
Please input function information here.
Definition = Oryza sativa Japonica Group Os05g0100401, complete gene.|
+
 
Source = Oryza sativa Japonica Group
+
===Expression===
 +
Please input expression information here.
 +
 
 +
===Evolution===
 +
Please input evolution information here.
 +
 
 +
You can also add sub-section(s) at will.
 +
 
 +
==Labs working on this gene==
 +
Please input related labs here.
 +
Rice (Oryza sativa), a salt-sensitive species, has considerable genetic variation for salt tolerance within the cultivated gene pool. Two indica rice genotypes, FL478, a recombinant inbred line derived from a population developed for salinity tolerance studies, and IR29, the sensitive parent of the population, were selected for this study. We used the Affymetrix rice genome array containing 55,515 probe sets to explore the transcriptome of the salt-tolerant and salt-sensitive genotypes under control and salinity-stressed conditions during vegetative growth. Response of the sensitive genotype IR29 is characterized by induction of a relatively large number of probe sets compared to tolerant FL478. Salinity stress induced a number of genes involved in the flavonoid biosynthesis pathway in IR29 but not in FL478. Cell wall-related genes were responsive in both genotypes, suggesting cell wall restructuring is a general adaptive mechanism during salinity stress, although the two genotypes also had some differences. Additionally, the expression of genes mapping to the Saltol region of chromosome 1 were examined in both genotypes. Single-feature polymorphism analysis of expression data revealed that IR29 was the source of the Saltol region in FL478, contrary to expectation. This study provides a genome-wide transcriptional analysis of two well-characterized, genetically related rice genotypes differing in salinity tolerance during a gradually imposed salinity stress under greenhouse conditions.
 +
 
 +
==References==
 +
Please input cited references here.
 +
Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan. PMID 18089549
 +
Rice Annotation Project, et al. Genome Res, 2007 Feb. PMID 17210932
 +
Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1. PMID 16381971
 +
International Rice Genome Sequencing Project. Nature, 2005 Aug 11. PMID 16100779
 +
Comparative Transcriptional Profiling of Two Contrasting Rice Genotypes under Salinity Stress during the Vegetative Growth Stage
 +
Harkamal Walia, Clyde Wilson, Pascal Condamine, Xuan Liu, Abdelbagi M. Ismail, Linghe Zeng, Steve I. Wanamaker, Jayati Mandal, Jin Xu, Xinping Cui, Timothy J. Close Plant Physiol. 2005 October; 139(2): 822–835. doi: 10.1104/pp.105.065961
 +
 
 +
==Structured Information==
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:16632..18751|
 
CDS = 17568..17724,17801..17964,18596..18751|
 
GCID = <gbrowseImage1>
 
name=NC_008398:16632..18751
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:16632..18751
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>cagcttcaagcgatagcttctgacgaaatggataacaagctgctccaactttacatatacgaaaaatccaggtcacctgggagattctttgatctagtttatcatgaaaatgcgcgtgtacttctccatgatgagagcatatatcgatttgaacggcgttcaaatcctacaagattatcaattcagctaatggagtatgggcatgaaaaacctgaagtaactgcagtgtcaattgatccaaatttttcgtcttatctatataatgagtatctgtcaagtatttctaatactaaattgtatgacgatatcttccttgggaggaataaacggaagcgtgggggaaacgatgactctcaagcttctttgaaggccattgatgctttcatggttactaatggtcttgaatgcaagatatcctgcaaatcctcaaaggtactcataattttagcgagaattttgtgccccattgcaagttaa</cdnaseq>|
 
AA = <aaseq>QLQAIASDEMDNKLLQLYIYEKSRSPGRFFDLVYHENARVLLHD                    ESIYRFERRSNPTRLSIQLMEYGHEKPEVTAVSIDPNFSSYLYNEYLSSISNTKLYDD                    IFLGRNKRKRGGNDDSQASLKAIDAFMVTNGLECKISCKSSKVLIILARILCPIAS</aaseq>|
 
DNA = <dnaseqindica>1028..1184#788..951#1..156#cagcttcaagcgatagcttctgacgaaatggataacaagctgctccaactttacatatacgaaaaatccaggtcacctgggagattctttgatctagtttatcatgaaaatgcgcgtgtacttctccatgatgagagcatatatcgatttgaacgggtaagtatttttacaatatccatgtttcttatttcgatacttttgcagtgccttattaccatgcaatattgttgctgcgacgaatgccaaataaatatactaccatattttgaagttaaaagtgcaaaattttctatcatcaaatataaaaaaaaatctataattcactacatgagatcaatcagcaactaggttgtgcgaagaacaatgtttcaaaagtatgctgcaaacaaaccacacctgtaaatgtttatccagcaacagagtatcttgtggagtggtggattggtgttgagcacacaagtttgaactgtttttatgaagtaaagaaaccctctttcttgctagtagttctgacttggtgcagagacttctgtaatgcctttagatgccttcgattcagagtttcagaccctccatggctccaccagtctagttttctagggtcaacaaatagagtgatacttctgcaagaaacgggaataccattgtataagggaaacctgaataccgttgtaaaaggggtgctagcaattttgacaattttttttcctgcctttatctgctaatgctatgtggcacaaggattttttgaccatgtatgtgacacagttttccttgtgatttgcagcgttcaaatcctacaagattatcaattcagctaatggagtatgggcatgaaaaacctgaagtaactgcagtgtcaattgatccaaatttttcgtcttatctatataatgagtatctgtcaagtatttctaatactaaattgtatgacgatatcttccttgggaggtactttcctgatcttatgttggagtctcaattttactttccacggctattttcattgttggacatcatttcccaggaataaacggaagcgtgggggaaacgatgactctcaagcttctttgaaggccattgatgctttcatggttactaatggtcttgaatgcaagatatcctgcaaatcctcaaaggtactcataattttagcgagaattttgtgccccattgcaagttaacattgtatctagcagaacccttttgattgatcatgataccattttgaccattttaatgttgtattttgtaatgctcaatatcttatttgcaggtttcctatgtccttgatactgaagatttcttatttcatataagaaagaggagagtttcatctagtggaaccatacctgaaaaggcggattttgtgaaagcttatgctgtaaaagtacagcgattccatagatttctatcaaggccctagggttaagcggcgaaattctggtaatcttttagctttattagattgtcattatgagcttcatgtttagtaaccttcacatgcatctttatattgtagtcagtcatcatatctggtaaagttacttatatgctgcttttgatcagttatacacgccgctgtctcatctatactctatatgtaggttgcacttagtttgctcccatcaaacgtgagcatcttgaaacttaactagcatcagtcaccactgcacaccatgcatcttgatttttgccaacaataaaagaaaaagacccttgaatctgagcatctacatccacgtttactgaatgcaatgtctctacaggcatgactgctgttaatttaaaacgatatttgtgatgtttctggtttgcagccgctgtatcaaatccgagatgctgacgtgcttcgaaaactgccatgtgaaccttaatattccaaaatttcagacaactgtacctttggaataatagatgggatactctggtaaatgctgaagtgtgtggcaaccgtgagttctcttaatggcctaaaattgtgtacatatgtatcatgagaatgcatttattcaggttaattgtactggctacactaacttgtcactcctgttaatatagttttgcatgttatcctatttttcttgggtgctatctgatacgcgcatgttcatgatgtt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001187234.1 RefSeq:Os05g0100401]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:25, 12 June 2015

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. Rice (Oryza sativa), a salt-sensitive species, has considerable genetic variation for salt tolerance within the cultivated gene pool. Two indica rice genotypes, FL478, a recombinant inbred line derived from a population developed for salinity tolerance studies, and IR29, the sensitive parent of the population, were selected for this study. We used the Affymetrix rice genome array containing 55,515 probe sets to explore the transcriptome of the salt-tolerant and salt-sensitive genotypes under control and salinity-stressed conditions during vegetative growth. Response of the sensitive genotype IR29 is characterized by induction of a relatively large number of probe sets compared to tolerant FL478. Salinity stress induced a number of genes involved in the flavonoid biosynthesis pathway in IR29 but not in FL478. Cell wall-related genes were responsive in both genotypes, suggesting cell wall restructuring is a general adaptive mechanism during salinity stress, although the two genotypes also had some differences. Additionally, the expression of genes mapping to the Saltol region of chromosome 1 were examined in both genotypes. Single-feature polymorphism analysis of expression data revealed that IR29 was the source of the Saltol region in FL478, contrary to expectation. This study provides a genome-wide transcriptional analysis of two well-characterized, genetically related rice genotypes differing in salinity tolerance during a gradually imposed salinity stress under greenhouse conditions.

References

Please input cited references here. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan. PMID 18089549 Rice Annotation Project, et al. Genome Res, 2007 Feb. PMID 17210932 Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1. PMID 16381971 International Rice Genome Sequencing Project. Nature, 2005 Aug 11. PMID 16100779 Comparative Transcriptional Profiling of Two Contrasting Rice Genotypes under Salinity Stress during the Vegetative Growth Stage Harkamal Walia, Clyde Wilson, Pascal Condamine, Xuan Liu, Abdelbagi M. Ismail, Linghe Zeng, Steve I. Wanamaker, Jayati Mandal, Jin Xu, Xinping Cui, Timothy J. Close Plant Physiol. 2005 October; 139(2): 822–835. doi: 10.1104/pp.105.065961

Structured Information