|
|
| (4 intermediate revisions by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| Line 6: |
Line 6: |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | Cytochrome P450s (CYPs) are heme-thiolate proteins, most of which catalyze NADPH- and O2-dependent hydroxylation reactions. P450s form a vast superfamily of genes that have been found in bacteria, insects, fish, mammals, plants, and fungi (Chapple, 1998). The nomenclature of P450s is based on amino acid sequence similarity. It assigns proteins with more than 40% identity into the same family, and proteins with more than 55% identity into the same subfamily (Werck-Reichhart and Feyereisen, 2000). Genomes of higher plants contain large number of P450s. For example, the Arabidopsis thaliana genome encodes 246 full-length P450s, accounting for approximately 1% of Arabidopsis gene complement. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| Line 12: |
Line 12: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | Department of Biochemistry, Biophysics, & Molecular Biology, Iowa State University, Ames, IA 50011, USA |
| | + | Rice Functional Genomics Group, Temasek Life Sciences Laboratory, National University of Singapore |
| | + | French National Centre for Scientific Research, Université Paris-Sud, France |
| | + | Department of Molecular Sciences and Center of Excellence in Genomics and Bioinformatics, University of Tennessee, Memphis |
| | + | Department of Plant Stress Response, Institute of Plant Molecular Biology |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | Akashi, T., Aoki, T., and Ayabe, S. (1998). Identification of a cytochrome P450 cDNA encoding (2S)-flavanone 2-hydroxylase of licorice (Glycyrrhiza echinata L.; Fabaceae) which represents licodione synthase and flavone synthase II. FEBS Lett. 431, 287-290. |
| | + | Chapple, C. (1998). Molecular-Genetic Analysis of Plant Cytochrome P450-Dependent Monooxygenases. Annu Rev Plant Physiol Plant Mol Biol 49, 311-343. |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os05g0101600|
| |
| − | Description = Cytochrome P450 family protein|
| |
| − | Version = NM_001060916.1 GI:115461562 GeneID:4337528|
| |
| − | Length = 2747 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os05g0101600, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
| |
| − | AP = Chromosome 5:79445..82191|
| |
| − | CDS = 79683..79785,79881..80035,80124..80230,80525..80603,80730..80810<br>,80943..81974|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008398:79445..82191
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008398:79445..82191
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgaatatggagtccctggcagcaggagcatggtgggtggttgtgcttcttctactcgtccttacaattgtggcctcctggtaccggtcatggtggaagacgaccgaagcgggggggccgctgcttcctcctccggcagctggtgcaggtccatggtgggtgtgggtgtggcagtggcgggagacggcggccttcctggcctcccatggcagcgggcggggattctaccacttcgtgcaggagcgctacaagttgtacaagggggagggggagggggaggcaacctgctgcttccgcaccgcgctcatggggcgcgtccacgtgttcgtgtccgcctcccaccccgccgcctcccaactcctcaccgccgaacctccccacttgcccaagcgctacgcccgcaccgccgccgacctgctcggcccccacagcatcctctgctccacctcccacgcccaccaccgccacgcccgccgcgccctcgccaccaccctcttcgccaccccttccaccgccgctttcgccgccgccttcgaccgcctcgtcatccgccactggactacgcttcttccgcctcataatcaaaaccaagtcgtcgtggtgctggacgccgctctccacataagctaccgcgccatctgcgagatgctgctgggcgccggcggcggaaagctgaggccgctgcagagcgacgtgttcgccgtcacgcaggccatgctggcgctgccgctgcgctggctgcccggcacgcgcttccgcaggggcctgcacgccaggaagcgcatcatggcggcgctcagggaggagatggcggccagaaatcaccatcaccatcaccatcaccatcaccacgacttgctcagcgtgctcatgcagaggcggcagcttggccatcccgacgccctcactgaggaccagattctggacaacatgctcaccctcatcatcgccggccaggttaccacggccaccgccatcacctggatggtcaagtatctcagcgacaaccgcctaatccaggacaagctacgggcagaagcatttcggctggagcttaagggtgattattctcttactatgcaacacctaaacgccatggactatgcgtacaaggcagtgaaagagtcgctgaggatggccactatagtttcctggtttccaagggtggcgctcaaggactgccaggttgcagggtttcacataaagaaggactggattgtaaatattgacgccaggtctctccactacgacccggatgttttcgacaacccaacggtgtttgatccttctaggttcgacgaagagggagagggagatgatgcgaagcttgggcgtgcacaaccacagaagaggaggctgctggtatttggagcaggcgggaggacatgtctggggatgaaccacgccaagatcatgatgcttatcttcctacaccgccttctcaccaatttcagatgggagatggcagatgacgatccaagccttgagaaatgggcaatgttccccaggttaaagaacggatgccccattctgctcacacccatccacaattcttga</cdnaseq>|
| |
| − | AA = <aaseq>MNMESLAAGAWWVVVLLLLVLTIVASWYRSWWKTTEAGGPLLPP PAAGAGPWWVWVWQWRETAAFLASHGSGRGFYHFVQERYKLYKGEGEGEATCCFRTAL MGRVHVFVSASHPAASQLLTAEPPHLPKRYARTAADLLGPHSILCSTSHAHHRHARRA LATTLFATPSTAAFAAAFDRLVIRHWTTLLPPHNQNQVVVVLDAALHISYRAICEMLL GAGGGKLRPLQSDVFAVTQAMLALPLRWLPGTRFRRGLHARKRIMAALREEMAARNHH HHHHHHHHDLLSVLMQRRQLGHPDALTEDQILDNMLTLIIAGQVTTATAITWMVKYLS DNRLIQDKLRAEAFRLELKGDYSLTMQHLNAMDYAYKAVKESLRMATIVSWFPRVALK DCQVAGFHIKKDWIVNIDARSLHYDPDVFDNPTVFDPSRFDEEGEGDDAKLGRAQPQK RRLLVFGAGGRTCLGMNHAKIMMLIFLHRLLTNFRWEMADDDPSLEKWAMFPRLKNGC PILLTPIHNS</aaseq>|
| |
| − | DNA = <dnaseqindica>2407..2509#2157..2311#1962..2068#1589..1667#1382..1462#218..1249#gttgacaagggattgagtgagtgcgttgtaacggtgggcatggagtggccttgtagctaggcttatcatgatgattgatgatatcggagtagaatttatcatcaaggcccaattaaggggcagggctcgatcagctgtttgtgtagttggagcgcgcggtggaagatgaacaagctcagcaacctagctagctagtcgtataccgatcgatcgatcgatgaatatggagtccctggcagcaggagcatggtgggtggttgtgcttcttctactcgtccttacaattgtggcctcctggtaccggtcatggtggaagacgaccgaagcgggggggccgctgcttcctcctccggcagctggtgcaggtccatggtgggtgtgggtgtggcagtggcgggagacggcggccttcctggcctcccatggcagcgggcggggattctaccacttcgtgcaggagcgctacaagttgtacaagggggagggggagggggaggcaacctgctgcttccgcaccgcgctcatggggcgcgtccacgtgttcgtgtccgcctcccaccccgccgcctcccaactcctcaccgccgaacctccccacttgcccaagcgctacgcccgcaccgccgccgacctgctcggcccccacagcatcctctgctccacctcccacgcccaccaccgccacgcccgccgcgccctcgccaccaccctcttcgccaccccttccaccgccgctttcgccgccgccttcgaccgcctcgtcatccgccactggactacgcttcttccgcctcataatcaaaaccaagtcgtcgtggtgctggacgccgctctccacataagctaccgcgccatctgcgagatgctgctgggcgccggcggcggaaagctgaggccgctgcagagcgacgtgttcgccgtcacgcaggccatgctggcgctgccgctgcgctggctgcccggcacgcgcttccgcaggggcctgcacgccaggaagcgcatcatggcggcgctcagggaggagatggcggccagaaatcaccatcaccatcaccatcaccatcaccacgacttgctcagcgtgctcatgcagaggcggcagcttggccatcccgacgccctcactgaggaccagattctggacaacatgctcaccctcatcatcgccggccaggttaccacggccaccgccatcacctggatggtcaagtatctcagcgacaaccgcctaatccaggacaagctacgggtcaactatcttcttctttctttctttctttctttctttcttcaaattttcaattcaatcaatacacttacataacatataggagtacctcacatacatgggcataattaattaattaattgtactgtgcaggcagaagcatttcggctggagcttaagggtgattattctcttactatgcaacacctaaacgccatggactatgcgtacaaggtaggtactccttctcccctgcatccccttgctaattggagtagtactagcaagcttcttaattaattattcctacttcttactgtaaagcttaacttcagctgtgagtacataatatttcatcaggcagtgaaagagtcgctgaggatggccactatagtttcctggtttccaagggtggcgctcaaggactgccaggttgcaggtgactggagtagtatcttacagtatactattattaatgtcttgctcaatacgaattcaaggaaattaattaagcttatactactactctctccgtttcacaatgtaagttattctagcatttctcacattcatattgatattaatgtatctagacatatatatttatttagattcattaatattaatattaatattaatgtaggaaatactagaatgacttatattgtgaaacggagaaagtagtacacttgacatgctgagtaattttgacattgcatgtatgtatatacagggtttcacataaagaaggactggattgtaaatattgacgccaggtctctccactacgacccggatgttttcgacaacccaacggtgtttgatccttctaggttcgacgtacgtacgaatttctttacttgcttggttgcctctacatttttctactatctgaatctgaattaagcaactgttgtagtgtctgcaggaagagggagagggagatgatgcgaagcttgggcgtgcacaaccacagaagaggaggctgctggtatttggagcaggcgggaggacatgtctggggatgaaccacgccaagatcatgatgcttatcttcctacaccgccttctcaccaatttcaggtaggttaggtactggagtaccagaaaccagatgatgctctctatctcgtcgactcttgtaatcgattacaacaacactgctgtgctgatttcagatgggagatggcagatgacgatccaagccttgagaaatgggcaatgttccccaggttaaagaacggatgccccattctgctcacacccatccacaattcttgataatgttccagattaattagattcttcatgatgacttgtggaccgtggctgcctagctactttatctgtttaattagtaaggtagtattaacaaaaactgctgtcaatttattcgaaactagcggtattgtactgtaactaatagcctagagatggaattcggaggaaggatattcctttgttatttgtaataaataaaaaagacctgctatctggagtagatgtatcaagactattc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060916.1 RefSeq:Os05g0101600]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Annotated Information
Function
Being by far the largest family of enzymes to support plant metabolism, the cytochrome P450s (CYPs) constitute an excellent reporter of metabolism architecture and evolution. The huge superfamily of CYPs found in angiosperms is built on the successful evolution of 11 ancestral genes, with very different fates and progenies. Essential functions in the production of structural components (membrane sterols), light harvesting (carotenoids) or hormone biosynthesis kept some of them under purifying selection, limiting duplication and sub/neofunctionalization
Expression
Cytochrome P450s (CYPs) are heme-thiolate proteins, most of which catalyze NADPH- and O2-dependent hydroxylation reactions. P450s form a vast superfamily of genes that have been found in bacteria, insects, fish, mammals, plants, and fungi (Chapple, 1998). The nomenclature of P450s is based on amino acid sequence similarity. It assigns proteins with more than 40% identity into the same family, and proteins with more than 55% identity into the same subfamily (Werck-Reichhart and Feyereisen, 2000). Genomes of higher plants contain large number of P450s. For example, the Arabidopsis thaliana genome encodes 246 full-length P450s, accounting for approximately 1% of Arabidopsis gene complement.
Evolution
CYP genes represent around 1% of the plant protein-coding genes, a proportion only outranked and approached by genes coding for regulatory proteins and some families of transcription
Labs working on this gene
Department of Biochemistry, Biophysics, & Molecular Biology, Iowa State University, Ames, IA 50011, USA
Rice Functional Genomics Group, Temasek Life Sciences Laboratory, National University of Singapore
French National Centre for Scientific Research, Université Paris-Sud, France
Department of Molecular Sciences and Center of Excellence in Genomics and Bioinformatics, University of Tennessee, Memphis
Department of Plant Stress Response, Institute of Plant Molecular Biology
References
Akashi, T., Aoki, T., and Ayabe, S. (1998). Identification of a cytochrome P450 cDNA encoding (2S)-flavanone 2-hydroxylase of licorice (Glycyrrhiza echinata L.; Fabaceae) which represents licodione synthase and flavone synthase II. FEBS Lett. 431, 287-290.
Chapple, C. (1998). Molecular-Genetic Analysis of Plant Cytochrome P450-Dependent Monooxygenases. Annu Rev Plant Physiol Plant Mol Biol 49, 311-343.
Structured Information