Difference between revisions of "Os05g0119000"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(2 intermediate revisions by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
Os05g0119000 is the gene STAR2 which is responsible for Al tolerance in rice, and it encodes a transmembrane domain, of a bacterial-type ATP binding cassette (ABC) transporter.
 
 
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
[[File:X_1.jpg|left|thumb|150px|Phylogenetic Relationship and Knockdown Assay of STAR2.]]
 +
Aluminum (Al) toxicity is a major factor limiting crop production in acidic soil, but the molecular mechanisms of Al tolerance are poorly understood. The gene STAR2 is responsible for Al tolerance in rice. Proteins encoded by STAR1 form a complex that functions as a unique ATP binding cassette (ABC) transporter, which is required for detoxification of Al in rice. The results described that STAR1 is translated to TMD, respectively, and then functions as an ABC transporter protein complex<ref name="ref1" />. However, the function of most ABC transporters is still unknown.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File:X_2.jpg|right|thumb|150px|Expression Analysis ofSTAR1andSTAR2.]]
 +
[[File:X_4.jpg|right|thumb|150px|Expression of STAR2 in different root segments.]]
 +
STAR2 is mainly expressed in the roots, and mRNA accumulation of STAR2 is significantly enhanced when seedlings were exposed to aluminum. A time-course experiment showed that the expression of STAR2 was similarly induced by aluminum as early as 2h after the exposure. Furthermore, an aluminum concentration as low as 5μM triggered the expression of STAR2, and the expression level increased with increasing external aluminum concentration. The mRNA accumulation of STAR2 does not respond to low pH and other metals, indicating that STAR2 is specifically induced by aluminum<ref name="ref1" />.
 +
Expression of STAR2 alone also resulted in current change, but it lost the specificity for the preloaded substrates (UDP-Glc, UDPGlcA, and water) probably due to increased membrane permeability for all substrates.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File:X_3.jpg|left|thumb|150px|Alignment of STAR2 and ALS3.]]
 
+
STAR2 is a homolog of ALS3, which is involved in Al tolerance in Arabidopsis<ref name="ref2" />. However, STAR2 and ALS3 differ in expression pattern and cellular localization. STAR2 is only expressed in the roots, whereas ALS3 is expressed in all organs, including roots, leaves, stems, and flowers <ref name="ref2" />.The expression of both STAR2 and ALS3 is induced by Al<ref name="ref2" />. In the roots exposed to Al, ALS3 is localized in the phloem and root tips. By contrast, STAR2 is localized in all cells excepting epidermal cells in the mature root zone.
You can also add sub-section(s) at will.
 
 
 
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
·Research Institute for Bioresources, Okayama University, Kurashiki 710-0046, Japan.
 +
·QTL Genomics Research Center, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.
 +
·Genome Resource Center, Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">Chao Feng Huang, Naoki Yamaji, Namiki Mitani, et.al. (2009) A Bacterial-Type ABC Transporter Is Involved in Aluminum Tolerance in Rice. The Plant Cell, Vol. 21: 655-667.</ref>
 +
<ref  name="ref2">Larsen, P.B., Geisler, M.J.B., Jones, C.A., Williams, K.M., and Cancel, J.D.(2005). ALS3encodes a phloem-localized ABC transporter-like protein that is required for aluminum tolerance inArabidopsis.Plant J.41:353–363.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os05g0119000|
 
Description = Conserved hypothetical protein 245 family protein|
 
Version = NM_001061014.1 GI:115461758 GeneID:4337635|
 
Length = 1139 bp|
 
Definition = Oryza sativa Japonica Group Os05g0119000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:967668..968806|
 
CDS = 967774..968631|
 
GCID = <gbrowseImage1>
 
name=NC_008398:967668..968806
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:967668..968806
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgatggcgagcatggcggcgctgctgcagcgtctgctggtggtggtgaatcaggtggacccgggcgcgccggggttctggcgggagttcttggtgggcatgctgaagccggtggcggcgacggcggtggtggcgatggcggtggcgctgagcttcacgcagcggctggggctcgagggcgagatgctgtacgccatggcgcgggcgttcctccagctctccgtcatcggcttcgtcctccagttcatcttcacccagaagagcgccgcctggatcctcctcgcctacctcttcatggtcaccgtcgccggctacaccgcggggcagcgcgcccgccacgtcccgcgggggaagcacatcgccgccgtctccatcctcgccggcacctccgtcaccatggccctcctcgtggcgctccgggtgttcccgttcacgccgcggtacatcatcccggtggccgggatgatggtcgggaacgcgatgacggtgaccggggtgacgatgaagaagctgagggaggacgtggggatgcagcgaggggtggtggagacggcgctggcgctgggcgcgacgccgcggcaggcgacggcgcggcaggtgaggaggtcgctggtgatcgcgctgtcgccggtgatcgacaacgccaagacggtggggctgatcgcgctgccgggcgccatgaccggcctcatcatgggcggcgcgtcgccgctggaggccatccagctgcagatcgtggtgatgaacatgctcatgggcgcttccaccgtcagcagcatcctctccacctacctctgctggccggccttcttcaccggcgccttccagctcaacgacgccgtcttcgccgccgactaa</cdnaseq>|
 
AA = <aaseq>MMASMAALLQRLLVVVNQVDPGAPGFWREFLVGMLKPVAATAVV                    AMAVALSFTQRLGLEGEMLYAMARAFLQLSVIGFVLQFIFTQKSAAWILLAYLFMVTV                    AGYTAGQRARHVPRGKHIAAVSILAGTSVTMALLVALRVFPFTPRYIIPVAGMMVGNA                    MTVTGVTMKKLREDVGMQRGVVETALALGATPRQATARQVRRSLVIALSPVIDNAKTV                    GLIALPGAMTGLIMGGASPLEAIQLQIVVMNMLMGASTVSSILSTYLCWPAFFTGAFQ                    LNDAVFAAD</aaseq>|
 
DNA = <dnaseqindica>107..964#gtcgcctccctcgctcgccgcctcccccgcttccgctcgctcaccaccaccaactcctcctcgtcttcatcaacgcgctcggtcgcctcgcctcgctctggaacgcatgatggcgagcatggcggcgctgctgcagcgtctgctggtggtggtgaatcaggtggacccgggcgcgccggggttctggcgggagttcttggtgggcatgctgaagccggtggcggcgacggcggtggtggcgatggcggtggcgctgagcttcacgcagcggctggggctcgagggcgagatgctgtacgccatggcgcgggcgttcctccagctctccgtcatcggcttcgtcctccagttcatcttcacccagaagagcgccgcctggatcctcctcgcctacctcttcatggtcaccgtcgccggctacaccgcggggcagcgcgcccgccacgtcccgcgggggaagcacatcgccgccgtctccatcctcgccggcacctccgtcaccatggccctcctcgtggcgctccgggtgttcccgttcacgccgcggtacatcatcccggtggccgggatgatggtcgggaacgcgatgacggtgaccggggtgacgatgaagaagctgagggaggacgtggggatgcagcgaggggtggtggagacggcgctggcgctgggcgcgacgccgcggcaggcgacggcgcggcaggtgaggaggtcgctggtgatcgcgctgtcgccggtgatcgacaacgccaagacggtggggctgatcgcgctgccgggcgccatgaccggcctcatcatgggcggcgcgtcgccgctggaggccatccagctgcagatcgtggtgatgaacatgctcatgggcgcttccaccgtcagcagcatcctctccacctacctctgctggccggccttcttcaccggcgccttccagctcaacgacgccgtcttcgccgccgactaatcttccctcttccacaacaccttgcattttgattcattatggattactgcttagtgattagtagtagtagtaattagttgttgagtacttacttagtaggacgagagagaaagtaagagtgtgtatgtcttgaggttaatttcttcttccataataaatcatgtgttgatgactt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061014.1 RefSeq:Os05g0119000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:27, 12 June 2015

Os05g0119000 is the gene STAR2 which is responsible for Al tolerance in rice, and it encodes a transmembrane domain, of a bacterial-type ATP binding cassette (ABC) transporter.

Annotated Information

Function

Phylogenetic Relationship and Knockdown Assay of STAR2.

Aluminum (Al) toxicity is a major factor limiting crop production in acidic soil, but the molecular mechanisms of Al tolerance are poorly understood. The gene STAR2 is responsible for Al tolerance in rice. Proteins encoded by STAR1 form a complex that functions as a unique ATP binding cassette (ABC) transporter, which is required for detoxification of Al in rice. The results described that STAR1 is translated to TMD, respectively, and then functions as an ABC transporter protein complex[1]. However, the function of most ABC transporters is still unknown.

Expression

Expression Analysis ofSTAR1andSTAR2.
Expression of STAR2 in different root segments.

STAR2 is mainly expressed in the roots, and mRNA accumulation of STAR2 is significantly enhanced when seedlings were exposed to aluminum. A time-course experiment showed that the expression of STAR2 was similarly induced by aluminum as early as 2h after the exposure. Furthermore, an aluminum concentration as low as 5μM triggered the expression of STAR2, and the expression level increased with increasing external aluminum concentration. The mRNA accumulation of STAR2 does not respond to low pH and other metals, indicating that STAR2 is specifically induced by aluminum[1]. Expression of STAR2 alone also resulted in current change, but it lost the specificity for the preloaded substrates (UDP-Glc, UDPGlcA, and water) probably due to increased membrane permeability for all substrates.

Evolution

Alignment of STAR2 and ALS3.

STAR2 is a homolog of ALS3, which is involved in Al tolerance in Arabidopsis[2]. However, STAR2 and ALS3 differ in expression pattern and cellular localization. STAR2 is only expressed in the roots, whereas ALS3 is expressed in all organs, including roots, leaves, stems, and flowers [2].The expression of both STAR2 and ALS3 is induced by Al[2]. In the roots exposed to Al, ALS3 is localized in the phloem and root tips. By contrast, STAR2 is localized in all cells excepting epidermal cells in the mature root zone.

Labs working on this gene

·Research Institute for Bioresources, Okayama University, Kurashiki 710-0046, Japan. ·QTL Genomics Research Center, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan. ·Genome Resource Center, Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.

References

  1. 1.0 1.1 Chao Feng Huang, Naoki Yamaji, Namiki Mitani, et.al. (2009) A Bacterial-Type ABC Transporter Is Involved in Aluminum Tolerance in Rice. The Plant Cell, Vol. 21: 655-667.
  2. 2.0 2.1 2.2 Larsen, P.B., Geisler, M.J.B., Jones, C.A., Williams, K.M., and Cancel, J.D.(2005). ALS3encodes a phloem-localized ABC transporter-like protein that is required for aluminum tolerance inArabidopsis.Plant J.41:353–363.

Structured Information