Difference between revisions of "Os05g0322900"

From RiceWiki
Jump to: navigation, search
(Expression)
(Structured Information)
 
(15 intermediate revisions by 3 users not shown)
Line 14: Line 14:
  
 
===Expression===
 
===Expression===
<ref name="ref5" />[[File:expression profiles of oswrky genes following m.grisea infection.png|right|thumb|150px|''Expression profiles of OsWRKY genes following M. grisea infection (from reference <ref name="ref5" />).'']]
+
[[File:expression profiles of oswrky genes following m.grisea infection.png|right|thumb|150px|''Expression profiles of OsWRKY genes following M. grisea infection (from reference <ref name="ref5" />).'']]
  
 
Full-length cDNA of ''OsWRKY45'' was isolated by RT-PCR using gene-specific primers encompassing the translation start codon and 3’-untranslated regions. The primers are 5’-AGCTGAGCTGCGAGGAAGA-3’ and 5’-CGAAAGCGGAAGAACAGGA-3’. The cDNA sequence has submitted to the NCBI database and the accession number is DQ298181.<ref name="ref5" />
 
Full-length cDNA of ''OsWRKY45'' was isolated by RT-PCR using gene-specific primers encompassing the translation start codon and 3’-untranslated regions. The primers are 5’-AGCTGAGCTGCGAGGAAGA-3’ and 5’-CGAAAGCGGAAGAACAGGA-3’. The cDNA sequence has submitted to the NCBI database and the accession number is DQ298181.<ref name="ref5" />
  
The expression of the ''OsWRKY45'' gene is investigated using RT-PCR in rice leaves infected with the avirulent M. grisea strain PO6-6 on RIL260. The expression profiling analysis revealed that the transcript levels of ''OsWRKY45'' is significantly increased by pathogen treatment.
+
The expression of the ''OsWRKY45'' gene is investigated using RT-PCR in rice leaves infected with the avirulent M. grisea strain PO6-6 on RIL260. The expression profiling analysis revealed that the transcript levels of ''OsWRKY45'' is significantly increased by pathogen treatment.<ref name="ref5" />
  
 
===Evolution===
 
===Evolution===
 +
[[File:phylogenetic tree of m grisea-inducible oswekys constructed using the nj method.png|right|thumb|150px|''phylogenetic tree of M. grisea-inducible OsWRKYs constructed using the neighbor-joining method (from reference <ref name="ref5" />).'']]
  
[[File:phylogenetic tree of m grisea-inducible oswekys constructed using the nj method.png|right|thumb|150px|''phylogenetic tree of M. grisea-inducible OsWRKYs constructed using the neighbor-joining method (from reference <ref name="ref3" />).'']]
+
The remaining ''M. grisea''-inducible WRKYs were included in four different groups: IIa (''OsWRKY62'' and ''OsWRKY76''), IIb (''OsWRKY32''), IId (''OsWRKY83''), and III (''OsWRKY45'' and ''OsWRKY64''). Only two ''M.grisea''-inducible WRKYs belong to the WRKY group III,previously considered to be a group associated with the defense response in Arabidopsis. WRKY group III includes ''AtWRKY70'', an Arabidopsis WRKY,that acts as an activator of SA-induced genes and a repressor of JA-responsive genes.<ref name="ref5" />
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 33: Line 34:
  
 
==References==
 
==References==
<ref name="ref1"></ref>
+
<references>
 +
<ref name="ref1">Tao Z, Liu H, Qiu D, et al. A pair of allelic WRKY genes play opposite roles in rice-bacteria interactions[J]. Plant physiology, 2009, 151(2): 936-948.</ref>
  
<ref name="ref2"></ref>
+
<ref name="ref2">Shimono M, Sugano S, Nakayama A, et al. Rice WRKY45 plays a crucial role in benzothiadiazole-inducible blast resistance[J]. The Plant Cell Online, 2007, 19(6): 2064-2076.</ref>
  
<ref name="ref3"></ref>
+
<ref name="ref3">Qiu Y, Yu D. Over-expression of the stress-induced ''OsWRKY45'' enhances disease resistance and drought tolerance in ''Arabidopsis'' [J]. Environmental and Experimental Botany, 2009, 65(1): 35-47.</ref>
  
<ref name="ref4"></ref>
+
<ref name="ref4">Tao Z, Kou Y, Liu H, et al. ''OsWRKY45'' alleles play different roles in abscisic acid signalling and salt stress tolerance but similar roles in drought and cold tolerance in rice[J]. Journal of experimental botany, 2011, 62(14): 4863-4874.</ref>
  
<ref name="ref5"></ref>
+
<ref name="ref5">Ryu H S, Han M, Lee S K, et al. A comprehensive expression analysis of the WRKY gene superfamily in rice plants during defense response[J]. Plant cell reports, 2006, 25(8): 836-847. </ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os05g0322900|
 
Description = Similar to WRKY transcription factor 45|
 
Version = NM_001061727.1 GI:115463184 GeneID:4338413|
 
Length = 2144 bp|
 
Definition = Oryza sativa Japonica Group Os05g0322900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:14969394..14971537|
 
CDS = 14969506..14969813,14970407..14970511,14970613..14971180|
 
GCID = <gbrowseImage1>
 
name=NC_008398:14969394..14971537
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:14969394..14971537
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgacgtcatcgatgtcgccggcgccggcgccggcgtacgcgcaggtgatggaggacatggagaaggggaaggagctggcggcgcagctgcaggggctcctccgcgactcgccggaggccggccgcttcgtcgaccagattctccacaccttctcccgggcgatgcgggcgctcgacaaggcggcggtctccgccgccggaggagaagggtcggaggtgcagagcgaggtcacctgcgggggcggggccagcgccggcgggaagaggaaagcccccgccgccgaccggaaggccaactgccgcaggaggacgcagcaatcgtccgggaattcggtggtcgtcaagaacctcgacgacggccaggcatggcgcaagtacgggcagaaggagatccaaaactccaagcacccaaaggcctacttccggtgcacgcacaagtacgaccagctgtgcacggcgcagcggcaggtgcagcgctgcgacgacgacccggcgagctacagggtcacctacatcggcgagcacacctgccgggacccggccaccgcccccatcatcgcggcgcacgtcatccaccaggtcgccgccggcgacaacgacgacggctgcggcggcctccaagcggggtcccgcctcatcagcttcgtcgccgcgccggcggcgccagtagacgctgccgcggcgccgacgaccagcacgatcaccacggtcaccgcgccgggcccgctgctgcagccgctcaaggtggagggcggcgtcggctcgtccgaccaggaggaggtgctgagcagcctcacgcccggcagctccgcggcgcgcggcggcggcggcggcggcggagtcgcgggtcccttcgggccggaccagggcgatgtcacgtcctccctgcactggagctacgacgccgtcgccggcatggagttcttcaagaacgacgaggttgtcttcgatctggacgacattatgggtttgagcttttga</cdnaseq>|
 
AA = <aaseq>MTSSMSPAPAPAYAQVMEDMEKGKELAAQLQGLLRDSPEAGRFV                    DQILHTFSRAMRALDKAAVSAAGGEGSEVQSEVTCGGGASAGGKRKAPAADRKANCRR                    RTQQSSGNSVVVKNLDDGQAWRKYGQKEIQNSKHPKAYFRCTHKYDQLCTAQRQVQRC                    DDDPASYRVTYIGEHTCRDPATAPIIAAHVIHQVAAGDNDDGCGGLQAGSRLISFVAA                    PAAPVDAAAAPTTSTITTVTAPGPLLQPLKVEGGVGSSDQEEVLSSLTPGSSAARGGG                    GGGGVAGPFGPDQGDVTSSLHWSYDAVAGMEFFKNDEVVFDLDDIMGLSF</aaseq>|
 
DNA = <dnaseqindica>113..420#1014..1118#1220..1787#tgctttgagctccatcaccagctgagctgcgaggaagagagagtgcgagagtgcgcggcagcggcagtgtagtgtcagtcactgggtgtgcgcttgcttgcttggattgaggatgacgtcatcgatgtcgccggcgccggcgccggcgtacgcgcaggtgatggaggacatggagaaggggaaggagctggcggcgcagctgcaggggctcctccgcgactcgccggaggccggccgcttcgtcgaccagattctccacaccttctcccgggcgatgcgggcgctcgacaaggcggcggtctccgccgccggaggagaagggtcggaggtgcagagcgaggtcacctgcgggggcggggccagcgccggcgggaagaggaaagcccccgccgccgaccggaaggccaactgccgcaggaggtgagaacgaaggccagagcatagctcatcacaaagcatagcatcatctgtgtgtaattagctgcgttctttcagggaagataggggggattgtccctcgttttccgcgcgcacgcttttcaaactactatacggtgcgtttttcgtataaattttctataggaaagttgctttaaaaaatcatattaatccatttttgaagtttcaaaatcataaaatcatgcgctaatggttcacctcgttttgcgtatattcccaatcttctctatttccttctcctcaaacacagcctgggagtgtttgagaaggggattgaggagattgggaagatacgtaaaacgaggtgagccattagctcatgattaattgagtattaactattttaaattttaaaaatagattaatatgattttttaaagcaactttcctatagaaattttttgcaaaaaacgtaccgtttaatagtttgaaaagcgtgcgcgcggaaaacgagagccaatctcccctatcacccctaaacgaacgataccttccctatcacccctaaacgaacgataccttaatgtactaagatttgtgtgtacgtattgcaggacgcagcaatcgtccgggaattcggtggtcgtcaagaacctcgacgacggccaggcatggcgcaagtacgggcagaaggagatccaaaactccaagcacccaaagtgagtagacttgtcccgacaaaaaacaatgtgttcgagactgtacagttggatgcgttgcgcgctgacgaggagttgtttggggtatgctacgtgtacagggcctacttccggtgcacgcacaagtacgaccagctgtgcacggcgcagcggcaggtgcagcgctgcgacgacgacccggcgagctacagggtcacctacatcggcgagcacacctgccgggacccggccaccgcccccatcatcgcggcgcacgtcatccaccaggtcgccgccggcgacaacgacgacggctgcggcggcctccaagcggggtcccgcctcatcagcttcgtcgccgcgccggcggcgccagtagacgctgccgcggcgccgacgaccagcacgatcaccacggtcaccgcgccgggcccgctgctgcagccgctcaaggtggagggcggcgtcggctcgtccgaccaggaggaggtgctgagcagcctcacgcccggcagctccgcggcgcgcggcggcggcggcggcggcggagtcgcgggtcccttcgggccggaccagggcgatgtcacgtcctccctgcactggagctacgacgccgtcgccggcatggagttcttcaagaacgacgaggttgtcttcgatctggacgacattatgggtttgagcttttgatcaccgaagaatcatggatggacacgggccgggtaaaacgatcgaaagaagatggattccacgcgtgtgtacagaaataattagcggcagcgcggatcttaatttggaacttgcaaagatactcctaattagcctggctagattagtttgtaaattccttgttgatgtgtcgtctcagctttaagctgcagacatgctagcaagtaacaacacgattagtacgtagtaatgtggttcttgattatgagctgggggtcttaaccttttttgtgtgacaagcaagagaagaggatttgggtacaatgtaatcctgttcttccgctttcgaaaaaaaaaaacatatagcttcacgtgcct</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061727.1 RefSeq:Os05g0322900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:33, 12 June 2015

Please input one-sentence summary here.

Annotated Information

OsWRKY45 is a member of the WRKY transcription factor family. The WRKY transcription factors in plant play important roles and act wildly in response to varies biotic and antibiotic stresses.

Function

A number of WRKY-type transcription factors from different plant species have been identified to play important roles in host-pathogen interactions. These WKRYs function either as positive or negative regulators in defense responses. Some WRKYs are both positive and negative regulators in different defense responses. Some other WRKYs have partly redundant functions in defense signaling.[1]

OsWRKY45, according to the rice genome annotation of The Institute for Genomic Research(http://rice.tigr.org) functioned downstream of OsWRKY13. Activation of OsWRKY13 repressed OsWRKY45 expression, and suppression of OsWRKY13 enhanced OsWRKY45 expression; furthermore, Xanthomonas oryzae pv oryzae(Xoo) infection influenced OsWRKY45 expression. These suggest that OsWRKY45 may be involved in rice-Xoo interactions.[1]

In addition, one study shows that OsWRKY45 transcription factor plays a crucial role in benzothiadiazole-inducible blast resistance. The RNA interference-mediated knockdown of OsWRKY45 compromised BTH-inducible resistance to blast disease, indicating that it is essential for BTH-induced defense responses.[2] another study shows that overexpressing OsWRKY45 in Arabidopsis enhanced resistance to the bacterial pathogen Pseudomonas syringae tomato and enhanced tolerance to salt and drought stresses and this gene may be involved in the signal pathways of both biotic and abiotic stress response. [3]

There are two alleles of OsWRKY45 functioned differently in rice-pathogen interactions. The allele[2] from japonica rice var Nipponbare is called OsWRKY45-1 and the alleles from indica rice var Minghui63 is called OsWRKY45-2. This pair of allelic genes encode proteins with a 10-amino acid difference, play opposite roles in rice (oryza sativa) resistance against bacterial pathogens. OsWRKY45-1-overexpressing plants showed increased susceptibility and OsWRKY45-1-knockout plants showed enhanced resistance to Xoo. OsWRKY45-2-overexpressing plants showed enhanced resistance and OsWRKY45-2-suppressing plants showed increased susceptibility to Xoo. Both OsWRKY45-1- and OsWRKY45-2 expressing plants showed enhanced resistance to M.grisea. OsWRKY45-1-regulated Xoo resistance was accompanied by increased accumulation of salicylic acid and jasmonic acid and induced expression of a subset of defense-responsive genes, while OsWRKY45-2-regulated Xoo resistance was accompanied by increased accumulation of jasmonic acid but not salicylic acid and induced expression of another subset of defense-responsive genes. These results suggest that both OsWRKY45-1and OsWRKY45-2 are positive regulators in rive resistance against M. grisea, but the former is a negative regulator and the latter is a positive regulator in rice resistance against Xoo . The opposite roles of the two allelic genes in rice-Xoo interaction appear to be due to their mediation of different defense signaling pathways.[1][4]

Expression

Expression profiles of OsWRKY genes following M. grisea infection (from reference [5]).

Full-length cDNA of OsWRKY45 was isolated by RT-PCR using gene-specific primers encompassing the translation start codon and 3’-untranslated regions. The primers are 5’-AGCTGAGCTGCGAGGAAGA-3’ and 5’-CGAAAGCGGAAGAACAGGA-3’. The cDNA sequence has submitted to the NCBI database and the accession number is DQ298181.[5]

The expression of the OsWRKY45 gene is investigated using RT-PCR in rice leaves infected with the avirulent M. grisea strain PO6-6 on RIL260. The expression profiling analysis revealed that the transcript levels of OsWRKY45 is significantly increased by pathogen treatment.[5]

Evolution

phylogenetic tree of M. grisea-inducible OsWRKYs constructed using the neighbor-joining method (from reference [5]).

The remaining M. grisea-inducible WRKYs were included in four different groups: IIa (OsWRKY62 and OsWRKY76), IIb (OsWRKY32), IId (OsWRKY83), and III (OsWRKY45 and OsWRKY64). Only two M.grisea-inducible WRKYs belong to the WRKY group III,previously considered to be a group associated with the defense response in Arabidopsis. WRKY group III includes AtWRKY70, an Arabidopsis WRKY,that acts as an activator of SA-induced genes and a repressor of JA-responsive genes.[5]

Labs working on this gene

  • National Key Labortory of Crop Genetic Improvement,National Center of Plant Gene Research(Wuhan),Huazhong Agricultural University, Wuhan 430070, China
  • Plant Disease Resisitance Research Unit, National Institute of Agrobiological Sciences, Ibaraki 305-8602, Japan
  • Plant Genetic Engineering Research Unit, National Institute of Agrobiological Sciences, Ibaraki 305-8602, Japan
  • Xishuangbanna Tropical Botanical Garden, Chinese Academy of Sciences, Kunming 650223, PR China
  • Graduate School of the Chinese Academy of Sciences, Beijing 100039,PR China
  • Graduate School of Biotechnology & Plant Metabolism Research Center, Kyung Hee University

References

  1. 1.0 1.1 1.2 Tao Z, Liu H, Qiu D, et al. A pair of allelic WRKY genes play opposite roles in rice-bacteria interactions[J]. Plant physiology, 2009, 151(2): 936-948.
  2. Shimono M, Sugano S, Nakayama A, et al. Rice WRKY45 plays a crucial role in benzothiadiazole-inducible blast resistance[J]. The Plant Cell Online, 2007, 19(6): 2064-2076.
  3. Qiu Y, Yu D. Over-expression of the stress-induced OsWRKY45 enhances disease resistance and drought tolerance in Arabidopsis [J]. Environmental and Experimental Botany, 2009, 65(1): 35-47.
  4. Tao Z, Kou Y, Liu H, et al. OsWRKY45 alleles play different roles in abscisic acid signalling and salt stress tolerance but similar roles in drought and cold tolerance in rice[J]. Journal of experimental botany, 2011, 62(14): 4863-4874.
  5. 5.0 5.1 5.2 5.3 5.4 Ryu H S, Han M, Lee S K, et al. A comprehensive expression analysis of the WRKY gene superfamily in rice plants during defense response[J]. Plant cell reports, 2006, 25(8): 836-847.

Structured Information