|
|
| (7 intermediate revisions by one other user not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | PathwayId of the Os05g0429900 include osa00061 and osa01040. The function of osa00061 is used in Fatty acid biosynthesis,and the function of osa01040 is used in Biosynthesis of unsaturated fatty acids.Their category are both included lipid metabolism.They both play a importnt role in the lipid metobolism.
| + | This gene may principally play roles in early heat response in rice. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | A genomic database search revealed that the rice genome encodes seven SACPD-like proteins that have 46 to 86% amino acid sequence identity with Arabidopsis SSI2Prediction of subcellular targeting by using the TargetP and WoLF PSORT prediction programs suggested that Os01g0919900,Os01g0880800, and Os08g0199400 are localized in the chloplast or mitochondrion, whereas the others are present in chloroplasts.These predictions are consistent with findings that FA synthesis in plants occurs mainly in plastids .
| + | MYBS3 activated cold signaling pathway in rice. Some research showed that, among 27 HR Myb genes, 17 genes were early activated, two (Os02g0624300 and Os05g0429900)were continuously up-regulated. |
| − | [[File:zxq1.png|200px|thumb|left|Fig. 1. RNA blot analysis.]]
| |
| − | | |
| − | | |
| − | Fig:Transcripts of OsSSI2, two OsSSI2 homologs,WRKY45, and PR1b were analyzed in wild-type (WT) and OsSSI2 mutant plants. OsSSI2 transcripts were not detected in homozygous Osssi2-Tos17 (NF7039) and OsSSI2-knockdown (kd) plants, whereas the expression of the two closest homologs of OsSSI2 (i.e., Os04g0379900 and
| |
| − | Os01g0880800) was unaffected in these plants. The arrow indicates a band of fusion transcripts encoding OsSSI2 with the Tos17 insertion. The salicylic
| |
| − | acid/benzothiadiazole-induced gene WRKY45 and the pathogenesis-related gene OsPR1b were constitutively expressed in the NF7039 and OsSSI2-kd plants. Leaf blades from the fourth leaves of seedlings were used.
| |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| Line 20: |
Line 14: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Plant Disease Resistance Research Unit, Division of Plant Science, National Institute of Agrobiological Sciences,
| + | Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China |
| − | Kannondai , Tsukuba, 305-8602 Japan; College of Agriculture, Ibaraki University, Ami 300-0393, Japan
| + | College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China |
| − | | + | Center of Analysis and Testing, Hunan Agricultural University, Changsha, China |
| − | Shanghai Agrobiological Gene Center, Shanghai, P. R. China
| |
| − | CAS Key Laboratory of Separation Science for Analytical Chemistry, Dalian Institute of Chemical Physics, Chinese
| |
| − | cademy of Sciences, Dalian, P. R. China
| |
| − | National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, P. R. China
| |
| | | | |
| | ==References== | | ==References== |
| − | Chang-Jie Jiang,1 Masaki Shimono,1 Satoru Maeda,1 Haruhiko Inoue,1 Masaki Mori,1Morifumi Hasegawa,2 Shoji Sugano,1 and Hiroshi Takatsuji1.Suppression of the Rice Fatty-Acid Desaturase Gene OsSSI2 Enhances Resistance to Blast and Leaf Blight Diseases in Rice.MPMI 2009,22(7): 820–829.
| + | Xianwen Zhang , Wirat Rerksiri, Ailing Liu , Xiaoyun Zhou , Hairong Xiong , Jianhua Xiang ,Xinbo Chen , Xingyao Xiong.Transcriptome profile reveals heat response mechanism at molecular and metabolic levels in rice flag leaf.Gene, 2013,530: 185–192. |
| − | | |
| − | Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.
| |
| − | | |
| − | Liebo Shu1, Qiaojun Lou, Chenfei Ma, Wei Ding, Jia Zhou, Jinhong Wu, Fangjun Feng,Xin Lu, Lijun Luo, Guowang Xu� and Hanwei Mei.Genetic, proteomic and metabolic analysis of the regulation of energy storage in rice seedlings in response to drought.Proteomics 2011, 11: 4122–4138.
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os05g0429900|
| |
| − | Description = Similar to MybHv5 (Fragment)|
| |
| − | Version = NM_001187510.1 GI:297724150 GeneID:9266213|
| |
| − | Length = 1279 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os05g0429900, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
| |
| − | AP = Chromosome 5:21106104..21107382|
| |
| − | CDS = 21106375..21106894,21106995..21107257|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008398:21106104..21107382
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008398:21106104..21107382
| |
| − | source=RiceChromosome05
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggggaggtcgccgtgctgcgagaaggcgcacacgaacaagggggcgtggacgaaggaggaggaccagcggctcatcgcgtacatcagggcgcatggcgaaggctgctggcgctcgctgcccaaggcggcgggcctccttcgctgcggcaagagctgccgcctccggtggatgaactacctccgccccgacctcaagcgcggcaacttcaccgacgacgaggacgagctcatcatccgcctccacagcctcctcggcaacaagtggtctctgatcgccgggcagctgccggggaggacggacaacgagatcaagaactactggaacacgcacatcaagcgcaagctcctcgcccgcggcatcgacccgcagacgcaccgcccgctgctcagcggcggtgacggcatcgcggcgagcaacaaggcggcaccaccgccgccgcatcccatatccgtcccggcgaaggcggcggccgcggcgatcttcgccgtggcgaagccgccgccgccgccgcgcccggtcgactcctcggacgacggctgccgcagcagcagcggcacaacgagcacgggggagccgcggtgccccgacctcaacctcgagctctcggtcgggccgacgccgagctcgccgccggcggagacgcccaccagcgcgcggccggtctgcctctgctaccacctcggcttccgcggcggggaggcgtgcagctgtcaggctgacagcaagggcccacacgagtttagatatttcaggccgttggaacaaggccagtacatatga</cdnaseq>|
| |
| − | AA = <aaseq>MGRSPCCEKAHTNKGAWTKEEDQRLIAYIRAHGEGCWRSLPKAA GLLRCGKSCRLRWMNYLRPDLKRGNFTDDEDELIIRLHSLLGNKWSLIAGQLPGRTDN EIKNYWNTHIKRKLLARGIDPQTHRPLLSGGDGIAASNKAAPPPPHPISVPAKAAAAA IFAVAKPPPPPRPVDSSDDGCRSSSGTTSTGEPRCPDLNLELSVGPTPSSPPAETPTS ARPVCLCYHLGFRGGEACSCQADSKGPHEFRYFRPLEQGQYI</aaseq>|
| |
| − | DNA = <dnaseqindica>489..1008#126..388#ccgccgcggctcacctggaaactgggcagattggacaatcgctcgagcgagctagcgagagagagcgcgagagagcgaggcggcgcgcgcggtggttgcggatttgtagcttagagcgcggggccatggggaggtcgccgtgctgcgagaaggcgcacacgaacaagggggcgtggacgaaggaggaggaccagcggctcatcgcgtacatcagggcgcatggcgaaggctgctggcgctcgctgcccaaggcggcgggcctccttcgctgcggcaagagctgccgcctccggtggatgaactacctccgccccgacctcaagcgcggcaacttcaccgacgacgaggacgagctcatcatccgcctccacagcctcctcggcaacaagtcagtctccctccccccgtctccggcgccgccgccaccgatcgatggagcattcatcaattccttgtgattctcaattcggtttcgcttcttctttcaggtggtctctgatcgccgggcagctgccggggaggacggacaacgagatcaagaactactggaacacgcacatcaagcgcaagctcctcgcccgcggcatcgacccgcagacgcaccgcccgctgctcagcggcggtgacggcatcgcggcgagcaacaaggcggcaccaccgccgccgcatcccatatccgtcccggcgaaggcggcggccgcggcgatcttcgccgtggcgaagccgccgccgccgccgcgcccggtcgactcctcggacgacggctgccgcagcagcagcggcacaacgagcacgggggagccgcggtgccccgacctcaacctcgagctctcggtcgggccgacgccgagctcgccgccggcggagacgcccaccagcgcgcggccggtctgcctctgctaccacctcggcttccgcggcggggaggcgtgcagctgtcaggctgacagcaagggcccacacgagtttagatatttcaggccgttggaacaaggccagtacatatgagatatgaccatgagatgtgagatggcttaattagcttcaattcccaacatgtgtaacacagggagtttttctagtggacgacaatactgtttaatttcagaaaaaaaaagggaaagaaaaaggttctaatctgttcatatttcttactattatccaatcttcatgatctcaatctctctctctctttattatttttctttgtagtaattaacttcatgttggttcctctaaaaaagattggtcgatgttattcagtgataaatattcctag</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001187510.1 RefSeq:Os05g0429900]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
This gene may principally play roles in early heat response in rice.
Expression
MYBS3 activated cold signaling pathway in rice. Some research showed that, among 27 HR Myb genes, 17 genes were early activated, two (Os02g0624300 and Os05g0429900)were continuously up-regulated.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China
College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China
Center of Analysis and Testing, Hunan Agricultural University, Changsha, China
References
Xianwen Zhang , Wirat Rerksiri, Ailing Liu , Xiaoyun Zhou , Hairong Xiong , Jianhua Xiang ,Xinbo Chen , Xingyao Xiong.Transcriptome profile reveals heat response mechanism at molecular and metabolic levels in rice flag leaf.Gene, 2013,530: 185–192.
Structured Information