Difference between revisions of "Os05g0543000"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Structured Information)
 
(8 intermediate revisions by one other user not shown)
Line 6: Line 6:
 
Germination of pollen and pollen tube elongation are significant processes in plant sexual reproduction. The apical cell wall of the pollen tube is exclusively made up of pectin. Pectins are synthesized and methylesterified in the Golgi and are later released in the apoplastic space. Further these methylesterified pectin polymers are demethylesterified by a class of enzymes named as pectin methyl esterases (PMEs). PMEs are ubiquitous enzymes and play an important role in pollen tube growth. In plants, the activity of PME is regulated either by differential expression or by PME inhibitor proteins (PMEI) (Micheli 2001). PMEI inhibit the activity of PME of plant origin and have a role in regulating cell wall stability at the tip of pollen tube (Di Matteo et al. 2005).”[2]''OSIPP3'' gene (coding for pectin methylesterase inhibitor protein) was isolated from a pre-pollinated inflorescence-specific cDNA library by differential screening of stage-specific libraries from Oryzasativa. ''OSIPP3''is present in the genome of rice as a single copy gene. ''OSIPP3'' gene was expressed exclusively in the pre-pollinated spikelets of rice.
 
Germination of pollen and pollen tube elongation are significant processes in plant sexual reproduction. The apical cell wall of the pollen tube is exclusively made up of pectin. Pectins are synthesized and methylesterified in the Golgi and are later released in the apoplastic space. Further these methylesterified pectin polymers are demethylesterified by a class of enzymes named as pectin methyl esterases (PMEs). PMEs are ubiquitous enzymes and play an important role in pollen tube growth. In plants, the activity of PME is regulated either by differential expression or by PME inhibitor proteins (PMEI) (Micheli 2001). PMEI inhibit the activity of PME of plant origin and have a role in regulating cell wall stability at the tip of pollen tube (Di Matteo et al. 2005).”[2]''OSIPP3'' gene (coding for pectin methylesterase inhibitor protein) was isolated from a pre-pollinated inflorescence-specific cDNA library by differential screening of stage-specific libraries from Oryzasativa. ''OSIPP3''is present in the genome of rice as a single copy gene. ''OSIPP3'' gene was expressed exclusively in the pre-pollinated spikelets of rice.
  
===Expression===
+
===Expression[2]===
''OSIPP3'' is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein. 5‘-upstream regulatory region (URR; Khurana
+
"''OSIPP3'' is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein. 5‘-upstream regulatory region (URR; Khurana
 
et al. 2012b) of OSIPP3 has been dissected by analyzing transgenic Arabidopsis plants harboring four deletions of upstream regulatory fragment (URF; will be used henceforth for denoting various deleted regions of ''OSIPP3'' URR) for determining cis-regulatory elements involved in gene regulation. Four deletions of URR of ''OSIPP3'' were transcriptionally fused to GUS reporter gene and transformed in Arabidopsis. ''OSIPP3''_del1 and del2 transgenic plants showed blue color corresponding to GUS expression in root,anther and silique. Plants harborin''g OSIPP3''_del3 construct showed GUS activity only in anthers and silique, while, pollen-specific expression was observed in case of ''OSIPP3''_del4 transgenics.
 
et al. 2012b) of OSIPP3 has been dissected by analyzing transgenic Arabidopsis plants harboring four deletions of upstream regulatory fragment (URF; will be used henceforth for denoting various deleted regions of ''OSIPP3'' URR) for determining cis-regulatory elements involved in gene regulation. Four deletions of URR of ''OSIPP3'' were transcriptionally fused to GUS reporter gene and transformed in Arabidopsis. ''OSIPP3''_del1 and del2 transgenic plants showed blue color corresponding to GUS expression in root,anther and silique. Plants harborin''g OSIPP3''_del3 construct showed GUS activity only in anthers and silique, while, pollen-specific expression was observed in case of ''OSIPP3''_del4 transgenics.
 
[[File:fig.111.png]][[File:fig.112.png]]
 
[[File:fig.111.png]][[File:fig.112.png]]
  
 
[[File:fig.113.png]]
 
[[File:fig.113.png]]
 +
"
  
 
===Evolution===
 
===Evolution===
Maojun Wang et al. did a study. In this study, the gene origin, evolution, and expression diversity of these two families were systematically analyzed using 11 representative species, including algae, bryophytes, lycophytes and flowering land plants. The results show that 1) for the two subfamilies (PME and proPME) of PME, the origin of the PME subfamily is consistent with the appearance of pectins in early charophyte cell walls, 2) Whole genome duplication (WGD) and tandem duplication contribute to the expansion of proPME and PMEI families in land plants, 3) Evidence of selection pressure shows that the proPME and PMEI families have rapidly evolved, particularly the PMEI family in vascular plants, and 4) Comparative expression profile analysis of the two families indicates that the eudicot Arabidopsis and monocot rice have different expression patterns. In addition, the gene structure and sequence analyses show that the origin of the PMEI domain may be derived from the neofunctionalization of the pro domain after WGD. This study will advance the evolutionary understanding of the PME and PMEI families and plant cell wall development.
+
Maojun Wang et al. did a study[1]. In this study, the gene origin, evolution, and expression diversity of these two families were systematically analyzed using 11 representative species, including algae, bryophytes, lycophytes and flowering land plants. The results show that 1) for the two subfamilies (PME and proPME) of PME, the origin of the PME subfamily is consistent with the appearance of pectins in early charophyte cell walls, 2) Whole genome duplication (WGD) and tandem duplication contribute to the expansion of proPME and PMEI families in land plants, 3) Evidence of selection pressure shows that the proPME and PMEI families have rapidly evolved, particularly the PMEI family in vascular plants, and 4) Comparative expression profile analysis of the two families indicates that the eudicot Arabidopsis and monocot rice have different expression patterns. In addition, the gene structure and sequence analyses show that the origin of the PMEI domain may be derived from the neofunctionalization of the pro domain after WGD. This study will advance the evolutionary understanding of the PME and PMEI families and plant cell wall development.
  
==Labs working on this gene==
+
=='''Labs working on this gene'''==
 
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, Hubei, China
 
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, Hubei, China
 +
 
2. Department of Plant Molecular Biology, Interdisciplinary Centre for Plant Genomics, University of Delhi South Campus, New Delhi 110021, India
 
2. Department of Plant Molecular Biology, Interdisciplinary Centre for Plant Genomics, University of Delhi South Campus, New Delhi 110021, India
 +
 
3. School of Natural Science and Mathematics, Indiana University East, Richmond, IN 47374, USA
 
3. School of Natural Science and Mathematics, Indiana University East, Richmond, IN 47374, USA
 +
 
4. National Institute of Immunology, Aruna Asaf Ali Marg, New Delhi 110067, India
 
4. National Institute of Immunology, Aruna Asaf Ali Marg, New Delhi 110067, India
 +
 
5. National Institute of Plant Genome Research, Aruna Asaf Ali Marg, New Delhi 110067, India
 
5. National Institute of Plant Genome Research, Aruna Asaf Ali Marg, New Delhi 110067, India
 +
 
6. School of Applied Biosciences, Kyungpook National University, Daegu 702-701, Republic of Korea
 
6. School of Applied Biosciences, Kyungpook National University, Daegu 702-701, Republic of Korea
 +
 
7.Department of Plant Molecular Systems Biotechnology, Kyung Hee University, Yongin 446-701, Republic of Korea
 
7.Department of Plant Molecular Systems Biotechnology, Kyung Hee University, Yongin 446-701, Republic of Korea
  
==References==
+
=='''References'''==
 
[1]Maojun Wang, Daojun Yuan mail, Wenhui Gao, Yang Li, Jiafu Tan, Xianlong Zhang et al. A Comparative Genome Analysis of PME and PMEI Families Reveals the Evolution of Pectin Metabolism in Plant Cell Walls. PLOS ONE. AUG 12 2013.
 
[1]Maojun Wang, Daojun Yuan mail, Wenhui Gao, Yang Li, Jiafu Tan, Xianlong Zhang et al. A Comparative Genome Analysis of PME and PMEI Families Reveals the Evolution of Pectin Metabolism in Plant Cell Walls. PLOS ONE. AUG 12 2013.
 +
 
[2]Reema Khurana, Hitesh Kathuria, Arnab Mukhopadhyay, Sanjay Kapoor, Akhilesh K. Tyagi et al. A 286 bp upstream regulatory region of a rice anther-Specific gene, OSIPP3, confers pollen-specific expression in Arabidopsis. Biotechnol Lett (2013) 35:455–462
 
[2]Reema Khurana, Hitesh Kathuria, Arnab Mukhopadhyay, Sanjay Kapoor, Akhilesh K. Tyagi et al. A 286 bp upstream regulatory region of a rice anther-Specific gene, OSIPP3, confers pollen-specific expression in Arabidopsis. Biotechnol Lett (2013) 35:455–462
  
==Structured Information==
+
=='''Structured Information'''==
{{JaponicaGene|
 
GeneName = Os05g0543000|
 
Description = Plant invertase/pectin methylesterase inhibitor domain containing protein|
 
Version = NM_001062735.1 GI:115465200 GeneID:4339485|
 
Length = 1347 bp|
 
Definition = Oryza sativa Japonica Group Os05g0543000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:27009633..27010979|
 
CDS = 27009778..27009975,27010401..27010823|
 
GCID = <gbrowseImage1>
 
name=NC_008398:27009633..27010979
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:27009633..27010979
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgcgattcgtcatcatctccgtcgtcgtcgtcgccgccttcgccgctgccgctgtcgttgaggcccgggttggacctatcgacgtcgctccgaccaacctgatcaccaacccactcggtgccatcatcgacaatggccgcaagatcaccggcgccgtcgtcgacgagtgcgcctggacctgcgatcatgtcgcggcgggtaacaagaagatgtgcaacacgctgaggaagctgccgggggtgagctcgccgaaggagctcctgacggcggcggtgaagctgtcgatgaggaaggcgaaggcggcgagggcgaggttcgaggcggcggcgagggcggcggagaaggggacgccgatggagtccatcctggacacctgcaaggaagggtacgacagcacggtgtcggcgctgcaggaggtgcagcgctgcatcgacgccaacgacagcaaggcgagcctcatcaccaagatgtcggcggcgaccaccttcaccggcgactgcggcaacgcctacgaggagcgggagctggagcccagcctcgcgctcaaggccaccaagaacaacgtcaaccgcgtcgtcaccggcgccctcgccatcgccgccaagctcaagctataa</cdnaseq>|
 
AA = <aaseq>MARFVIISVVVVAAFAAAAVVEARVGPIDVAPTNLITNPLGAII                    DNGRKITGAVVDECAWTCDHVAAGNKKMCNTLRKLPGVSSPKELLTAAVKLSMRKAKA                    ARARFEAAARAAEKGTPMESILDTCKEGYDSTVSALQEVQRCIDANDSKASLITKMSA                    ATTFTGDCGNAYEERELEPSLALKATKNNVNRVVTGALAIAAKLKL</aaseq>|
 
DNA = <dnaseqindica>146..343#769..1191#agccatcaccaaaccttttagcttctcagccttttgcctctctttctactctctttcttggccgtctctcttatatccctcaatttaaccatcgagggcggccaaaaaaaagagagaaaggaagagcaaaataacacattacaccatggcgcgattcgtcatcatctccgtcgtcgtcgtcgccgccttcgccgctgccgctgtcgttgaggcccgggttggacctatcgacgtcgctccgaccaacctgatcaccaacccactcggtgccatcatcgacaatggccgcaagatcaccggcgccgtcgtcgacgagtgcgcctggacctgcgatcatgtcgcggtgagtgacgacactattgtccatggaagcttattttgatcgctcgagagggtccctcgtatttatatgtcacttaaataattataaaaaaattaaaaaaattaagaagacgtgttaacctgtgatatatcaccccacaaacatacacgttcaaattcaacttctgtatctcgcaacgaaaaaaataaattaaaccaaatatagatgtttaatttgaacttggatatttgtgaagtgatatataacatgttaatacatcttctcgaattttttttaatttttttataactatttgagtgacatgtaaacaatgagggaatgatgttcctcgagggattaaaatccactcccgctccagaaatggtcagaaaattacttactgctcatgtcatggatgaacagtctgtctattgatgttgatgcaggcgggtaacaagaagatgtgcaacacgctgaggaagctgccgggggtgagctcgccgaaggagctcctgacggcggcggtgaagctgtcgatgaggaaggcgaaggcggcgagggcgaggttcgaggcggcggcgagggcggcggagaaggggacgccgatggagtccatcctggacacctgcaaggaagggtacgacagcacggtgtcggcgctgcaggaggtgcagcgctgcatcgacgccaacgacagcaaggcgagcctcatcaccaagatgtcggcggcgaccaccttcaccggcgactgcggcaacgcctacgaggagcgggagctggagcccagcctcgcgctcaaggccaccaagaacaacgtcaaccgcgtcgtcaccggcgccctcgccatcgccgccaagctcaagctataattagccaactgatcatcaatcgatatgaatgattgatcaactataaaattacacctagctcatgcatgcgtccgcgcgttatgtgtgtacgcacgcatgcatatgtgtaagatcgatcaacagatcacagaagtggtggcgtatctcgcacttgtg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062735.1 RefSeq:Os05g0543000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:43, 12 June 2015

Please input one-sentence summary here.

Annotated Information

Function

“Pectins are fundamental polysaccharides in the plant primary cell wall. ”[1] “OSIPP3 is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein. Germination of pollen and pollen tube elongation are significant processes in plant sexual reproduction. The apical cell wall of the pollen tube is exclusively made up of pectin. Pectins are synthesized and methylesterified in the Golgi and are later released in the apoplastic space. Further these methylesterified pectin polymers are demethylesterified by a class of enzymes named as pectin methyl esterases (PMEs). PMEs are ubiquitous enzymes and play an important role in pollen tube growth. In plants, the activity of PME is regulated either by differential expression or by PME inhibitor proteins (PMEI) (Micheli 2001). PMEI inhibit the activity of PME of plant origin and have a role in regulating cell wall stability at the tip of pollen tube (Di Matteo et al. 2005).”[2]OSIPP3 gene (coding for pectin methylesterase inhibitor protein) was isolated from a pre-pollinated inflorescence-specific cDNA library by differential screening of stage-specific libraries from Oryzasativa. OSIPP3is present in the genome of rice as a single copy gene. OSIPP3 gene was expressed exclusively in the pre-pollinated spikelets of rice.

Expression[2]

"OSIPP3 is an anther-specific gene of rice encoding pectin methylesterase inhibitor family protein. 5‘-upstream regulatory region (URR; Khurana et al. 2012b) of OSIPP3 has been dissected by analyzing transgenic Arabidopsis plants harboring four deletions of upstream regulatory fragment (URF; will be used henceforth for denoting various deleted regions of OSIPP3 URR) for determining cis-regulatory elements involved in gene regulation. Four deletions of URR of OSIPP3 were transcriptionally fused to GUS reporter gene and transformed in Arabidopsis. OSIPP3_del1 and del2 transgenic plants showed blue color corresponding to GUS expression in root,anther and silique. Plants harboring OSIPP3_del3 construct showed GUS activity only in anthers and silique, while, pollen-specific expression was observed in case of OSIPP3_del4 transgenics. Fig.111.pngFig.112.png

Fig.113.png "

Evolution

Maojun Wang et al. did a study[1]. In this study, the gene origin, evolution, and expression diversity of these two families were systematically analyzed using 11 representative species, including algae, bryophytes, lycophytes and flowering land plants. The results show that 1) for the two subfamilies (PME and proPME) of PME, the origin of the PME subfamily is consistent with the appearance of pectins in early charophyte cell walls, 2) Whole genome duplication (WGD) and tandem duplication contribute to the expansion of proPME and PMEI families in land plants, 3) Evidence of selection pressure shows that the proPME and PMEI families have rapidly evolved, particularly the PMEI family in vascular plants, and 4) Comparative expression profile analysis of the two families indicates that the eudicot Arabidopsis and monocot rice have different expression patterns. In addition, the gene structure and sequence analyses show that the origin of the PMEI domain may be derived from the neofunctionalization of the pro domain after WGD. This study will advance the evolutionary understanding of the PME and PMEI families and plant cell wall development.

Labs working on this gene

1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan, Hubei, China

2. Department of Plant Molecular Biology, Interdisciplinary Centre for Plant Genomics, University of Delhi South Campus, New Delhi 110021, India

3. School of Natural Science and Mathematics, Indiana University East, Richmond, IN 47374, USA

4. National Institute of Immunology, Aruna Asaf Ali Marg, New Delhi 110067, India

5. National Institute of Plant Genome Research, Aruna Asaf Ali Marg, New Delhi 110067, India

6. School of Applied Biosciences, Kyungpook National University, Daegu 702-701, Republic of Korea

7.Department of Plant Molecular Systems Biotechnology, Kyung Hee University, Yongin 446-701, Republic of Korea

References

[1]Maojun Wang, Daojun Yuan mail, Wenhui Gao, Yang Li, Jiafu Tan, Xianlong Zhang et al. A Comparative Genome Analysis of PME and PMEI Families Reveals the Evolution of Pectin Metabolism in Plant Cell Walls. PLOS ONE. AUG 12 2013.

[2]Reema Khurana, Hitesh Kathuria, Arnab Mukhopadhyay, Sanjay Kapoor, Akhilesh K. Tyagi et al. A 286 bp upstream regulatory region of a rice anther-Specific gene, OSIPP3, confers pollen-specific expression in Arabidopsis. Biotechnol Lett (2013) 35:455–462

Structured Information