Difference between revisions of "Os05g0553400"

From RiceWiki
Jump to: navigation, search
(Expression)
(Structured Information)
 
(28 intermediate revisions by one other user not shown)
Line 4: Line 4:
 
===Function===
 
===Function===
 
OsMYB55 is a transcription factor of R2R3-MYBs family members.OsMYB55 binds to the promoter regions of target genes and directly activates expression of some of several genes involved in amino acids metabolism including glutamine synthetase (OsGS1;2) glutamine amidotransferase(GAT1) and glutamate decarboxylase 3 (GAD3).The MYB plant transcription factor family members regulate numerous processes during the plant life cycle and are also involved in response to various environmental stresses <ref name="ref1" />.The MYB proteins are classified into three major groups based on the number of adjacent repeats in the binding domain; R1R2R3-MYB, R2R3-MYB, and R1-MYB. Most plant MYB proteins are of the R2R3 type.The R2R3-MYBs are involved in a wide range of physiological responses such as regulation of the isopropanoid and flavonoid pathways,control of the cell cycle, root growth,and various defense and stress responses <ref name="ref2" />.Molecular and biochemical analysis revealed that OsMYB55 enhances amino acid metabolic pathways crucial for normal plant growth and development under high temperature.
 
OsMYB55 is a transcription factor of R2R3-MYBs family members.OsMYB55 binds to the promoter regions of target genes and directly activates expression of some of several genes involved in amino acids metabolism including glutamine synthetase (OsGS1;2) glutamine amidotransferase(GAT1) and glutamate decarboxylase 3 (GAD3).The MYB plant transcription factor family members regulate numerous processes during the plant life cycle and are also involved in response to various environmental stresses <ref name="ref1" />.The MYB proteins are classified into three major groups based on the number of adjacent repeats in the binding domain; R1R2R3-MYB, R2R3-MYB, and R1-MYB. Most plant MYB proteins are of the R2R3 type.The R2R3-MYBs are involved in a wide range of physiological responses such as regulation of the isopropanoid and flavonoid pathways,control of the cell cycle, root growth,and various defense and stress responses <ref name="ref2" />.Molecular and biochemical analysis revealed that OsMYB55 enhances amino acid metabolic pathways crucial for normal plant growth and development under high temperature.
 +
 +
 +
 +
 +
 +
=== Subcellular localization ===
 +
The subcellular localization suggests that OsMYB55 is a nuclear protein, which is expressed in nuclei.
  
 
===Expression===
 
===Expression===
Line 19: Line 26:
 
that the enhancement of amino acid biosynthesis, especially of
 
that the enhancement of amino acid biosynthesis, especially of
 
proline, GABA and arginine has a significant impact in improving
 
proline, GABA and arginine has a significant impact in improving
plant tolerance to different stress conditions[3].
+
plant tolerance to different stress conditions<ref name="ref3" />.
  
 
===Evolution===
 
===Evolution===
Line 25: Line 32:
 
This gene was identified for nitrogen regulated genes. The BLAST search program for identifying homologs of OsMYB55 shows Oryza Sativa (Os05g0553400), Sorghum bicolor (242088749), Zea mays (226509454), Vitis vinifera (296081600), Populus trichocarpa (224092242), Malus x domestica (71041104), Dacus carota (134026414), Glycine max (255642827) and Arabidopsis thaliana (15242793).
 
This gene was identified for nitrogen regulated genes. The BLAST search program for identifying homologs of OsMYB55 shows Oryza Sativa (Os05g0553400), Sorghum bicolor (242088749), Zea mays (226509454), Vitis vinifera (296081600), Populus trichocarpa (224092242), Malus x domestica (71041104), Dacus carota (134026414), Glycine max (255642827) and Arabidopsis thaliana (15242793).
  
== Knowledge Extension ==
+
=== Knowledge Extension ===
overexpression of OsMYB55 leads to increased
+
Overexpression of OsMYB55 leads to increased
 
heat tolerance of rice plants during the vegetative stage. This leads
 
heat tolerance of rice plants during the vegetative stage. This leads
 
to increased biomass and if the plants are subsequently grown
 
to increased biomass and if the plants are subsequently grown
under moderate conditions leads to increased seed yield. One
+
under moderate conditions leads to increased seed yield<ref name="ref6" />. One
 
explanation for this is that increasing the amino acid content at the
 
explanation for this is that increasing the amino acid content at the
 
vegetative stage through the action of OsMYB55 could help the
 
vegetative stage through the action of OsMYB55 could help the
Line 37: Line 44:
 
many important rice growing regions are decreased due to higher
 
many important rice growing regions are decreased due to higher
 
temperatures given global warming. Therefore, it is of great
 
temperatures given global warming. Therefore, it is of great
importance to explore different crop genetic solutions to ameliorate
+
importance to explore different crop genetic solutions to ameliorate.These amino
 +
acids have multifunctional roles in plants that help plant tissues
 +
resist and recover from stress <ref name="ref4" />. Additionally, arginine has been
 +
reported to have a major role in improving wheat yield under high
 +
temperature conditions <ref name="ref5" />.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Please input related labs here.
 
Please input related labs here.
 +
* Department of Biochemistry and Molecular Biology, Mississippi State University, MS 39762, USA;
 +
* Institute of Biotechnology, Viikinkaari 1, FI-00790, University of Helsinki, Finland
 +
* Science Complex, University of Guelph, Guelph, Ontario, Canada
 +
* Gustavo Bonaventure, Max Planck Institute for Chemical Ecology, Germany
  
 
==References==
 
==References==
[1]Smolen GA, Pawlowski L, Wilensky SE, Bender J (2002) Dominant alleles of the
+
<references>
basic helix-loop-helix transcription factor ATR2 activate stress-responsive genes
+
<ref name="ref1">
in Arabidopsis. Genetics 161: 1235–1246.
+
Smolen GA, Pawlowski L, Wilensky SE, Bender J (2002) Dominant alleles of the basic helix-loop-helix transcription factor ATR2 activate stress-responsive genes in Arabidopsis. Genetics 161: 1235–1246.</ref>
 +
<ref name="ref2">Raffaele S, Vailleau F, Leger A, Joubes J, Miersch O, et al. (2008) A MYB transcription factor regulates very-long-chain fatty acid biosynthesis for activation of the hypersensitive cell death response in Arabidopsis. Plant Cell 20: 752–767.</ref>
 +
<ref name="ref3">Kinnersley AM, Turano FJ (2000) Gamma Aminobutyric Acid (GABA) and Plant Responses to Stress. Crit Rev Plant Sci 19: 479–509. </ref>
 +
<ref name="ref4">Szabados L, Savoure´ A (2010) Proline: a multifunctional amino acid. Trends in
 +
Plant Science 15: 89–97.</ref>
 +
<ref name="ref5">Hozayn M, Abd El-Monem AA (2010) Alleviation of the potential impact of
 +
climate change on wheat productivity using arginine under irrigated Egyptian
 +
agriculture. Opions Me´diterrane´ennes. 95: 95–100.</ref>
 +
<ref name="ref6">Ashraf El-kereamy;Yong-Mei Bi;Kosala Ranathunge;Perrin H. Beatty;Allen G. Good;Steven J. Rothstein The Rice R2R3-MYB Transcription Factor OsMYB55 Is Involved in the Tolerance to High Temperature and Modulates Amino Acid Metabolism PLoS ONE, 2012, 7(12): e52030</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os05g0553400|
 
Description = Similar to Myb-related transcription factor-like protein (MYB transcription factor)|
 
Version = NM_001062798.1 GI:115465326 GeneID:4339548|
 
Length = 1457 bp|
 
Definition = Oryza sativa Japonica Group Os05g0553400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:27606367..27607823|
 
CDS = 27606601..27607204,27607297..27607426,27607530..27607665|
 
GCID = <gbrowseImage1>
 
name=NC_008398:27606367..27607823
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:27606367..27607823
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggggcgcgcgccgtgctgcgacaaggcgagcgtgaagcgggggccgtggtcgccggaggaggacgagcagctgcggagctacgtccagagccacggcatcggcggcaactggatcgcgctcccgcagaaagcagggctcaaccgctgcggcaagagctgcaggctccggtggctcaactacctgaggccggacatcaagcacggcggctacaccgagcaggaggaccacatcatctgctcgctctacaactcgattggaagcaggtggtccatcatcgcgtcgaagctccccggccggactgacaacgacgtcaagaactactggaacaccaagctcaagaagaaagccatgggcgccgtgcagccgcgcgccgccgcctcggcgccgagccaatgcacgtcgtcagcgatggcgccggcgctctcgccggcctcctcgtccgtcaccagctcgagcggcgacgcctgcttcgccgccgccgccaccaccaccaccaccatgtacccgccaccgacgacgccgccgcagcagcagttcatccgcttcgacgcaccacccgcggcggcggcggcggcatccccgaccgacctcgcgcccgtgccaccaccggccaccgtcacggcggacggcgacggcggctgggcgtccgacgccttgtccctcgacgacgtgttcctcggcgagctcacggccggcgagccgctgttcccttacgccgagctgttcagcggcttcgccggcgcggcgccggacagcaaggccaccttggagctctcggcgtgctacttcccgaacatggcggagatgtgggcggcctccgaccacgcctacgccaagccacagggtctctgcaacaccctgacatag</cdnaseq>|
 
AA = <aaseq>MGRAPCCDKASVKRGPWSPEEDEQLRSYVQSHGIGGNWIALPQK                    AGLNRCGKSCRLRWLNYLRPDIKHGGYTEQEDHIICSLYNSIGSRWSIIASKLPGRTD                    NDVKNYWNTKLKKKAMGAVQPRAAASAPSQCTSSAMAPALSPASSSVTSSSGDACFAA                    AATTTTTMYPPPTTPPQQQFIRFDAPPAAAAAASPTDLAPVPPPATVTADGDGGWASD                    ALSLDDVFLGELTAGEPLFPYAELFSGFAGAAPDSKATLELSACYFPNMAEMWAASDH                    AYAKPQGLCNTLT</aaseq>|
 
DNA = <dnaseqindica>620..1223#398..527#159..294#atcggtcggtctcggtcgctgccgtccctgtgcttggagtagacacgagccggtgacgcgcatatcgtcttctgctcgagatcgatcgatcgatcgcttggttggttgctgcgactgcgagggaggccgcgggtggtgaggaggattgtgcaaaaaaaatggggcgcgcgccgtgctgcgacaaggcgagcgtgaagcgggggccgtggtcgccggaggaggacgagcagctgcggagctacgtccagagccacggcatcggcggcaactggatcgcgctcccgcagaaagcaggtcggtattagtgcactgctcgtcgtcgtcgatgctagccggtgatgaaacgccatgtttgtatgtgaattctgatgtctgcgtgttctcttgtgtgattcagggctcaaccgctgcggcaagagctgcaggctccggtggctcaactacctgaggccggacatcaagcacggcggctacaccgagcaggaggaccacatcatctgctcgctctacaactcgattggaagcaggtgatgatttaagccggagatgaatatttcttttttctttcactgatcctgttctgagttcttgaactgactctgtttgcgtgcgttgccaggtggtccatcatcgcgtcgaagctccccggccggactgacaacgacgtcaagaactactggaacaccaagctcaagaagaaagccatgggcgccgtgcagccgcgcgccgccgcctcggcgccgagccaatgcacgtcgtcagcgatggcgccggcgctctcgccggcctcctcgtccgtcaccagctcgagcggcgacgcctgcttcgccgccgccgccaccaccaccaccaccatgtacccgccaccgacgacgccgccgcagcagcagttcatccgcttcgacgcaccacccgcggcggcggcggcggcatccccgaccgacctcgcgcccgtgccaccaccggccaccgtcacggcggacggcgacggcggctgggcgtccgacgccttgtccctcgacgacgtgttcctcggcgagctcacggccggcgagccgctgttcccttacgccgagctgttcagcggcttcgccggcgcggcgccggacagcaaggccaccttggagctctcggcgtgctacttcccgaacatggcggagatgtgggcggcctccgaccacgcctacgccaagccacagggtctctgcaacaccctgacataggaggacacgctaaaacctccattgaattcttgcgtagctgcgaacgcaacggcgatcgatcgatgcgtcgccacttgctactagcataattcttgctctcttttttttttcaatttttttctcttcttcgagtggcccattctctagctggcgttttctcgtgtattatgagtgatcgattattacatgtaaattaatccatagatgtatctgcactgatccaaattctccagc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062798.1 RefSeq:Os05g0553400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:44, 12 June 2015

The rice gene OsMYB55 can enhance the vegetative growth and improve grain yield of rice growth under high temperature conditions.

Annotated Information

Function

OsMYB55 is a transcription factor of R2R3-MYBs family members.OsMYB55 binds to the promoter regions of target genes and directly activates expression of some of several genes involved in amino acids metabolism including glutamine synthetase (OsGS1;2) glutamine amidotransferase(GAT1) and glutamate decarboxylase 3 (GAD3).The MYB plant transcription factor family members regulate numerous processes during the plant life cycle and are also involved in response to various environmental stresses [1].The MYB proteins are classified into three major groups based on the number of adjacent repeats in the binding domain; R1R2R3-MYB, R2R3-MYB, and R1-MYB. Most plant MYB proteins are of the R2R3 type.The R2R3-MYBs are involved in a wide range of physiological responses such as regulation of the isopropanoid and flavonoid pathways,control of the cell cycle, root growth,and various defense and stress responses [2].Molecular and biochemical analysis revealed that OsMYB55 enhances amino acid metabolic pathways crucial for normal plant growth and development under high temperature.



Subcellular localization

The subcellular localization suggests that OsMYB55 is a nuclear protein, which is expressed in nuclei.

Expression

OsMYB55 is more Specifically Expressed at the Vegetative Stage.Expression analysis of the OsMYB55 revealed that transcript levels are higher at the vegetative stages up to tillering and the inflorescence stage. The transcription was higher in the root tissues compared to the leaves at these stages. However, its lowest expression level was observed in all seed development stages and at seed maturation.Expression analysis of the transgenic plants showed that OsMYB55 transcript levels were between fifty and ninety times higher in the transgenic lines than in the wild type plants.OsMYB55 overexpression leads to improved heat tolerance and enhances the level of total amino acids and glutamine acid, proline, arginine, and GABA in particular. It has been reported that the enhancement of amino acid biosynthesis, especially of proline, GABA and arginine has a significant impact in improving plant tolerance to different stress conditions[3].

Evolution

The 867 bp full length cDNA sequence of OsMYB55(Os05g0553400) encodes a R2R3-MYB transcription factor predicted to be 289 amino acids long. This gene was identified for nitrogen regulated genes. The BLAST search program for identifying homologs of OsMYB55 shows Oryza Sativa (Os05g0553400), Sorghum bicolor (242088749), Zea mays (226509454), Vitis vinifera (296081600), Populus trichocarpa (224092242), Malus x domestica (71041104), Dacus carota (134026414), Glycine max (255642827) and Arabidopsis thaliana (15242793).

Knowledge Extension

Overexpression of OsMYB55 leads to increased heat tolerance of rice plants during the vegetative stage. This leads to increased biomass and if the plants are subsequently grown under moderate conditions leads to increased seed yield[4]. One explanation for this is that increasing the amino acid content at the vegetative stage through the action of OsMYB55 could help the plant in the flower initiation process which occurs at this stage thus resulting in a higher yield when compared to the wild type plants. This trait will become of increasing importance as crop yields in many important rice growing regions are decreased due to higher temperatures given global warming. Therefore, it is of great importance to explore different crop genetic solutions to ameliorate.These amino acids have multifunctional roles in plants that help plant tissues resist and recover from stress [5]. Additionally, arginine has been reported to have a major role in improving wheat yield under high temperature conditions [6].

Labs working on this gene

Please input related labs here.

* Department of Biochemistry and Molecular Biology, Mississippi State University, MS 39762, USA; 
* Institute of Biotechnology, Viikinkaari 1, FI-00790, University of Helsinki, Finland
* Science Complex, University of Guelph, Guelph, Ontario, Canada
* Gustavo Bonaventure, Max Planck Institute for Chemical Ecology, Germany

References

  1. Smolen GA, Pawlowski L, Wilensky SE, Bender J (2002) Dominant alleles of the basic helix-loop-helix transcription factor ATR2 activate stress-responsive genes in Arabidopsis. Genetics 161: 1235–1246.
  2. Raffaele S, Vailleau F, Leger A, Joubes J, Miersch O, et al. (2008) A MYB transcription factor regulates very-long-chain fatty acid biosynthesis for activation of the hypersensitive cell death response in Arabidopsis. Plant Cell 20: 752–767.
  3. Kinnersley AM, Turano FJ (2000) Gamma Aminobutyric Acid (GABA) and Plant Responses to Stress. Crit Rev Plant Sci 19: 479–509.
  4. Ashraf El-kereamy;Yong-Mei Bi;Kosala Ranathunge;Perrin H. Beatty;Allen G. Good;Steven J. Rothstein The Rice R2R3-MYB Transcription Factor OsMYB55 Is Involved in the Tolerance to High Temperature and Modulates Amino Acid Metabolism PLoS ONE, 2012, 7(12): e52030
  5. Szabados L, Savoure´ A (2010) Proline: a multifunctional amino acid. Trends in Plant Science 15: 89–97.
  6. Hozayn M, Abd El-Monem AA (2010) Alleviation of the potential impact of climate change on wheat productivity using arginine under irrigated Egyptian agriculture. Opions Me´diterrane´ennes. 95: 95–100.

Structured Information