Difference between revisions of "Os05g0584200"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os05g0584200| Description = Similar to Late embryogenesis abundant protein Lea14-A| Version = NM_001062984.1 GI:115465698 GeneID:4339745| Length...")
 
(Structured Information)
 
(7 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
Please input one-sentence summary here.
GeneName = Os05g0584200|
+
 
Description = Similar to Late embryogenesis abundant protein Lea14-A|
+
 
Version = NM_001062984.1 GI:115465698 GeneID:4339745|
+
The OsLEA5 polypeptide isrich in Leu (10%), Ser (8.6%), and Asp (8.6%), while Cys,Trp, and Gln residue contents are very low, which are
Length = 1237 bp|
+
2, 1.3, and 1.3%, respectively.
Definition = Oryza sativa Japonica Group Os05g0584200, complete gene.|
+
==Annotated Information==
Source = Oryza sativa Japonica Group
+
===Function===
 +
Please input function information here.
 +
Therefore,
 +
in this work, the repeated freeze–thaw regime was selected
 +
to investigate the cryophylactic function of OsLEA5 in E. coli cells. Herein, it was found that the expression of the
 +
OsLEA5 protein could directly contribute to the enhanced
 +
thermotolerance and cryophylactic of recombinant bacteria
 +
cells. In general, both the denaturation and dysfunction of
 +
proteins and damage of cellular architectures occur when
 +
cells are subjected to low- or high-temperature stress. The
 +
protective effect of OsLEA5 might be due to the maintenance
 +
of proteins in a functional conformation (Reyes et al.
 +
2008). Hence, it is suggested that the
 +
OsLEA5 protein would play an important role in protecting
 +
the host cells survival from extreme temperature stress,
 +
which has action similar to the heat shock protein.Experimental evidence
 +
here conforms that OsLEA5 is important in maintaining
 +
BL/OsLEA5 cell survival during ultraviolet light stress.Although the scientific literature
 +
provides few answers for such question, it is
 +
assumed that OsLEA5 probably perform the role of protective
 +
molecules cooperated with other factors to protect
 +
cellular components against ROS-induced damage and
 +
even an additional role as repair mechanisms in eliminating
 +
the thymine dimer produced by photochemical injury of
 +
UV radiation. It is concluded that the OsLEA5 may have a
 +
unique function among LEA proteins, in that it is involved
 +
in protecting cells against UV radiation stress.In summary, the rice OsLEA5 gene encodes a LEA-like
 +
protein with an average negative hydropathy. It is classified
 +
as the non-typical group 5C with highly hydrophobic,
 +
intrinsically ordered and specific amino acid composition
 +
and distribution, the most extraordinary LEA protein group
 +
compared with canonical and other atypical LEAs. Realtime
 +
PCR analysis showed that OsLEA5 can express in
 +
different tissue organs at all times. The expression levels of
 +
OsLEA5 in the roots and panicles of full ripe stage were
 +
dramatically increased in comparison with other tissueorgan. The experimental finding showed that overexpression
 +
of OsLEA5 in transgenic E. coli enhanced cell viability
 +
and significantly improved tolerance under diverse
 +
abiotic stresses, and the OsLEA5 protein protected LDH
 +
against the inactivation induced by abiotic stress. Our
 +
research suggested that OsLEA5 had multiple protective
 +
efficiencies in response to a broader range of abiotic stress
 +
conditions.
 +
 
 +
===Expression===
 +
Please input expression information here.
 +
In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.
 +
 
 +
===Evolution===
 +
Please input evolution information here.
 +
 
 +
You can also add sub-section(s) at will.
 +
[[File:Fig.4.jpg]]
 +
 
 +
==Labs working on this gene==
 +
Please input related labs here.
 +
Key Laboratory of Biorheological Science and Technology,
 +
Ministry of Education, College of Bioengineering,
 +
Chongqing University, Chongqing 400044, China
 +
 
 +
==References==
 +
Please input cited references here.
 +
1. Shuai He;Lili Tan;Zongli Hu;Guoping Chen;Guixue Wang;Tingzhang Hu
 +
  Molecular characterization and functional analysis by heterologous expression in E. coli under diverse abiotic stresses for OsLEA5, the atypical hydrophobic LEA protein from Oryza sativa L.
 +
  Molecular Genetics and Genomics, 2011, 287(1): 39-54
 +
 
 +
==Structured Information==
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
 
AP = Chromosome 5:29070275..29071511|
 
CDS = 29070755..29070960,29071073..29071322|
 
GCID = <gbrowseImage1>
 
name=NC_008398:29070275..29071511
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008398:29070275..29071511
 
source=RiceChromosome05
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaacgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaa</cdnaseq>|
 
AA = <aaseq>MSSLMDKAKGFVAEKIAHIPKPEASLDSLSFKGMSRECITVHSN                    VNVSNPYDHRLPICELTYTLKCAGNVVASGTMPDPGWIAASDTTKLEIPAKIPYDFLI                    SLVKDVGRDWDIDYQLDVGLTIDLPIVGNFTIPLSTSGEMKLPTLKDMF</aaseq>|
 
DNA = <dnaseqindica>481..686#799..1048#agtgcagagatgggatcgccgatcagtgagcgattcggtgcaggcaactgataaggagggaggatctctccgccgactcagcaccgtccgtttcgggacgtggtgccgttttggccccgcgccgaagcttctcccctttgcagttatcaaattccccttgcagccacgcagatttacgccgcgcccccacgcaacccaaaagttcagcgtaaacttgcctatcaacaaaactacagctcaggcggccacgcgaaatcgcgaggtttcacgtaccaaaagcgcaaaaatccactcggattccacgcggccgagccactgcacgtgggcgcccacgacgcgcccccgtatcgatcggcaccgcgctttcctcctcctgatcttacccgctactatatcatcatctgcttgctttccccccgagagtccacggcctcctgctcctctcgatccaagataatttcactccagcgtgcgtcggccatgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaagtacgtgtcacagctagcttttgcttgtccgatcgatgatccatccatctcacgctcgatcgaattgtgctaattgtgtattggtcgatttggattgattggtcatcatcagcgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaattatcttatctctaatctcatcaaccaactccgatcgatcgaactctctgtatgtgtgatgtgtctcgcgaataatggcagctgctctgcacctgtgttcttcttgccctgcatagtatagcatggctgtatgagcggctgaaaaattacctctattcctaatggttgcaataataagctagagaactg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062984.1 RefSeq:Os05g0584200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 07:45, 12 June 2015

Please input one-sentence summary here.


The OsLEA5 polypeptide isrich in Leu (10%), Ser (8.6%), and Asp (8.6%), while Cys,Trp, and Gln residue contents are very low, which are 2, 1.3, and 1.3%, respectively.

Annotated Information

Function

Please input function information here. Therefore, in this work, the repeated freeze–thaw regime was selected to investigate the cryophylactic function of OsLEA5 in E. coli cells. Herein, it was found that the expression of the OsLEA5 protein could directly contribute to the enhanced thermotolerance and cryophylactic of recombinant bacteria cells. In general, both the denaturation and dysfunction of proteins and damage of cellular architectures occur when cells are subjected to low- or high-temperature stress. The protective effect of OsLEA5 might be due to the maintenance of proteins in a functional conformation (Reyes et al. 2008). Hence, it is suggested that the OsLEA5 protein would play an important role in protecting the host cells survival from extreme temperature stress, which has action similar to the heat shock protein.Experimental evidence here conforms that OsLEA5 is important in maintaining BL/OsLEA5 cell survival during ultraviolet light stress.Although the scientific literature provides few answers for such question, it is assumed that OsLEA5 probably perform the role of protective molecules cooperated with other factors to protect cellular components against ROS-induced damage and even an additional role as repair mechanisms in eliminating the thymine dimer produced by photochemical injury of UV radiation. It is concluded that the OsLEA5 may have a unique function among LEA proteins, in that it is involved in protecting cells against UV radiation stress.In summary, the rice OsLEA5 gene encodes a LEA-like protein with an average negative hydropathy. It is classified as the non-typical group 5C with highly hydrophobic, intrinsically ordered and specific amino acid composition and distribution, the most extraordinary LEA protein group compared with canonical and other atypical LEAs. Realtime PCR analysis showed that OsLEA5 can express in different tissue organs at all times. The expression levels of OsLEA5 in the roots and panicles of full ripe stage were dramatically increased in comparison with other tissueorgan. The experimental finding showed that overexpression of OsLEA5 in transgenic E. coli enhanced cell viability and significantly improved tolerance under diverse abiotic stresses, and the OsLEA5 protein protected LDH against the inactivation induced by abiotic stress. Our research suggested that OsLEA5 had multiple protective efficiencies in response to a broader range of abiotic stress conditions.

Expression

Please input expression information here. In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. Fig.4.jpg

Labs working on this gene

Please input related labs here. Key Laboratory of Biorheological Science and Technology, Ministry of Education, College of Bioengineering, Chongqing University, Chongqing 400044, China

References

Please input cited references here. 1. Shuai He;Lili Tan;Zongli Hu;Guoping Chen;Guixue Wang;Tingzhang Hu

 Molecular characterization and functional analysis by heterologous expression in E. coli under diverse abiotic stresses for OsLEA5, the atypical hydrophobic LEA protein from Oryza sativa L.
 Molecular Genetics and Genomics, 2011, 287(1): 39-54

Structured Information