|
|
| (9 intermediate revisions by one other user not shown) |
| Line 4: |
Line 4: |
| | ===Function=== | | ===Function=== |
| | Os06g0125000 is a protein-coding gene. The protein Os06g0125000 translated share most of it's amino acid sequence(Query Cover: 99%) with one kind of plants' disease resistance protein which is coding by bacterial resistance gene Resistance to Pseudomonas syringae pv. maculicola 1 (RPM1). | | Os06g0125000 is a protein-coding gene. The protein Os06g0125000 translated share most of it's amino acid sequence(Query Cover: 99%) with one kind of plants' disease resistance protein which is coding by bacterial resistance gene Resistance to Pseudomonas syringae pv. maculicola 1 (RPM1). |
| | + | |
| | + | The disease resistance protein which RPM1 translated is cytoplasmic localized receptor-like protein, it enable detection of numerous microbial effector proteins, which have been released within the host cell and have specific functions which collectively suppress defense and/or reconfigure host metabolism to nourish pathogen growth. The suite of pathogen effectors varies considerably among pathogens, with bacterial pathogens capable of delivering tens of effectors, whereas fungi and oomycetes are predicted to deliver hundreds of effectors. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | The bacterial resistance gene Resistance to Pseudomonas syringae pv. maculicola 1 (RPM1), encodes a classic cytoplasmic receptor-like protein that is characterized by an amino termi- nal coiled-coil domain, a central nucleotide binding (NB) site and a carboxyl terminal LRR domain. RPM1 was one of the first plant resistance genes to be molecularly described from studies of natural variation in Arabidopsis thaliana (Grant et al., 1995). More- over, RPM1 was the first example of a dual specificity R-protein, recognizing the sequence-unrelated AvrB and AvrRpm1 effector proteins derived from bacterial pathogens of soybean and Brassica species, respectively (Bisgrove et al., 1994). Actual dual specificity recognition is through effector-mediated modifications of RPM1- interacting protein 4 (RIN4) in the presence of the bacterial type III effector proteins AvrRpm1 or AvrB (Mackey et al., 2002). | + | The bacterial resistance gene Resistance to Pseudomonas syringae pv. maculicola 1 (RPM1), encodes a classic cytoplasmic receptor-like protein that is characterized by an amino terminal coiled-coil domain, a central nucleotide binding (NB) site and a carboxyl terminal LRR domain. RPM1 was one of the first plant resistance genes to be molecularly described from studies of natural variation in Arabidopsis thaliana (Grant et al., 1995). Moreover, RPM1 was the first example of a dual specificity R-protein, recognizing the sequence-unrelated AvrB and AvrRpm1 effector proteins derived from bacterial pathogens of soybean and Brassica species, respectively (Bisgrove et al., 1994). Actual dual specificity recognition is through effector-mediated modifications of RPM1- interacting protein 4 (RIN4) in the presence of the bacterial type III effector proteins AvrRpm1 or AvrB (Mackey et al., 2002). |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| Line 12: |
Line 14: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | nstitute of Population Genetics, Heinrich-Heine Universität, Düsseldorf, Germany |
| | + | |
| | + | MolecularandComputationalBiology,UniversityofSouthernCalifornia,LosAngeles,CA,USA |
| | + | |
| | + | School of Biosciences, University of Exeter, Exeter, UK |
| | + | |
| | + | SchoolofLifeSciences,UniversityofWarwick,Wellesbourne,UK |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | 1. Grant, M. R., Godiard, L., Straube, E., Ashfield, T., Lewald, J., Sattler, A., et al. (1995). Structure of the Arabidopsis Rpm1 gene enabling dual- specificity disease resistance. Science 269, 843–846. |
| | + | |
| | + | 2. Bisgrove, S. R., Simonich, M. T., Smith, N. M., Sattler, A., and Innes, R. W. (1994). A disease resistance gene in Arabidopsis with specificity for 2 different pathogen avirulence genes. Plant Cell 6, 927–933. |
| | + | |
| | + | 3. Mackey, D., Holt, B. F., Wiig, A., and Dangl, J. L. (2002). Rin4 interacts with Pseudomonas syringae type III effector molecules and is required for RPM1-mediated resistance in Arabidopsis. Cell 108, 743–754. |
| | + | |
| | + | 4. Grant, M. R., McDowell, J. M., Sharpe, A. G., Zabala, M. D. T., Lydiate, D. J., Dangl, J. L., et al. (1998). Independent deletions of a pathogen- resistance gene in Brassica and Arabidopsis. Proc. Natl. Acad. Sci. U.S.A. 95, 15843–15848. |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0125000|
| |
| − | Description = Similar to NBS-LRR disease resistance protein homologue|
| |
| − | Version = NM_001063182.1 GI:115466095 GeneID:4339959|
| |
| − | Length = 3904 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0125000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:1346281..1350184|
| |
| − | CDS = 1346281..1349188,1350069..1350184|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:1346281..1350184
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:1346281..1350184
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcggagacggcgctgagcatggcgaggtccatgctggggggcgccatcagcgcggcttcggcggccgccggcgaagagatgagcttgctcatgggtgtgcagaaggagatatggttcatgaatgatgagctaaaaacaatgcaagcgttcctaatagctgctgaaacaatgaagaagaaggacctgctgttgaaggtgtgggctgagcaagtaaggagcttgtcctacgacattgaagattgtcttgaagagtttatggtccatgtcggaaaccaaagcctcttgcagcaattgacaaatctcaaagatcgccaccgaatagctgtcaagattcgcaacctcaaatcaagacttgaagaagtgagcagcagaaacacacgttacaactcgatcaagatggaggcgaacaacaccttcgatgagatcgagtccatggaggatgttcggaatcattctcgtagcaacatcgacgaagcaaagcttgtaggctttgacacccccaaaaaggagttacttgacaagataaacatggatgccaatgatgatgaccactgtcgggtgctttgtgtggttggcatgggaggattgggtaagactactctggtaaggaagatctttgaaagtaaggaagacatcataaataattttccacatcgtgcttggatcgttgtgtcacagtcattttcgatgatagagatgctcaaagatatgattagccaacttctaggtcatgaatcattgaaaagatttgaagggaagccgatccgagcacacgaccttggtacgcacctacgagatggactgaaagaattgaggtactttgttgtttttgatgacttgtggaacacagatcactgggaatggattagggaatttgctttgcctagtaaaaacaacaaaaggagtcgggtgattgtaacaaccagattagatggagtagctaatgcatgcaccactgaaccatttgtctaccgccttaagctcctagagacggaatgtgccatagatttgctactaaggaagatgggggaaagtaaagaagatatgaagaatgataacaacctgaagagcatagttacacaattagtaaaaaagtgtggttgtttaccactagccatagtaacgataggagcaatgtttgctaataaaccttcgtcgaagtgggaagaaatgtgcagacaacttccttcagagcttgagaacaacccaagccctggagtcgaagcaataaggagggtggtgaccctaagctatggccatttgccatctcatcttaaaccatgctatctatatctaagcatttttcctgaggatattgaaattaaaaggaggcatttggtaaacagatgggtagcggaggggttggttagagctagagttggaatgaccattagtgatgtcggagaaagctactttgatgagctaattagccgaagtatgattcaaccatcaagggtgaatatggaaggacatgttaagagctgccgggtccatgatataatgcgtgatattatagtctcaatttctaaagaggagaattttgtttactcaacaggagataatgtatctacagtaatagtggagaagttccgtcatctgtcatgccatggcggcaactacccaatagttggaatggatttcagtcgtgtccgatcgttaactgtatttggtgagtttgatcagagacccatgttggtgggctcttcaatttgttcagctcaattcacgatgctaagagtcttggatctagagaatgcagtattttcagtgacacaaaaagacataaacaaaattgggttgttgcggcacttgagatatttgaatacgcatactagaagacggtccactatttatgcacttccaagctctatcgggaaattacagaacttacaagttttggacataagagagagtgaaatttctacactaccaactgatatcagtaagctccttatgcttcgtatcctccgttgtagcaagggaccgtggtacttctacttctattttgatccagatgaaccaataaaatgcttgaagcatacgttgcgcatgcccttgatgttgacaccattagttggttctgcagcacgcaattatactattgctgagctacacagggcctactctagccattggtcagagacaccaggcgtgagggttccaacaggaatcagcaaactaaaggagttgcaggtcttagaggttgtagaccttaaactaactaaaagcaaagcaattgaagagctgggtgaacttcgctggctacaaaaattacgggtgtcaacaaagggggcccaggacaagaagcgcaagacactttgtgaagccatcgagaagctatcatccctccaatctctctgtgtttatgagggttactacttcataactgggacacttgagtggctgggtccttgcaatttctcccctcctcccctgctgagaaagctagagttgcatggacgtattcgcgtgatgcccgactcttttaggaaccttaagcagctgcggaagatttttttgcggctaagcgaactagatggtagagccatagagatacttggaacactacccaacctcatgctcctgaatctcgatggcagagcatatgttgggaatgaattagcattcaaaaagcacgagttcccaaatctcaaggagcttcgtatcagtatgctgtccgaactaagagggataagatttgagaaggacgccttgccccacatggaaagaatggaaatcgaatgttgccagttgagatcagggattgttggcatcaagcacctcgaacagctcaacgagatttcacttgggtgtgatgtggcggggcttgatctgctggaacaggaagtaaaggcgcaccccaagacacccgcattgcggctgcttcaagaccgaagcaaaatcgacttggggctccctgtagtcctgacgaaagacgaaggctccaatgttgaagaggaagcaaaggaatccgtccatgacgatgccggggagagctcgcaagtgatctcatcaccgtga</cdnaseq>|
| |
| − | AA = <aaseq>MAETALSMARSMLGGAISAASAAAGEEMSLLMGVQKEIWFMNDE LKTMQAFLIAAETMKKKDLLLKVWAEQVRSLSYDIEDCLEEFMVHVGNQSLLQQLTNL KDRHRIAVKIRNLKSRLEEVSSRNTRYNSIKMEANNTFDEIESMEDVRNHSRSNIDEA KLVGFDTPKKELLDKINMDANDDDHCRVLCVVGMGGLGKTTLVRKIFESKEDIINNFP HRAWIVVSQSFSMIEMLKDMISQLLGHESLKRFEGKPIRAHDLGTHLRDGLKELRYFV VFDDLWNTDHWEWIREFALPSKNNKRSRVIVTTRLDGVANACTTEPFVYRLKLLETEC AIDLLLRKMGESKEDMKNDNNLKSIVTQLVKKCGCLPLAIVTIGAMFANKPSSKWEEM CRQLPSELENNPSPGVEAIRRVVTLSYGHLPSHLKPCYLYLSIFPEDIEIKRRHLVNR WVAEGLVRARVGMTISDVGESYFDELISRSMIQPSRVNMEGHVKSCRVHDIMRDIIVS ISKEENFVYSTGDNVSTVIVEKFRHLSCHGGNYPIVGMDFSRVRSLTVFGEFDQRPML VGSSICSAQFTMLRVLDLENAVFSVTQKDINKIGLLRHLRYLNTHTRRRSTIYALPSS IGKLQNLQVLDIRESEISTLPTDISKLLMLRILRCSKGPWYFYFYFDPDEPIKCLKHT LRMPLMLTPLVGSAARNYTIAELHRAYSSHWSETPGVRVPTGISKLKELQVLEVVDLK LTKSKAIEELGELRWLQKLRVSTKGAQDKKRKTLCEAIEKLSSLQSLCVYEGYYFITG TLEWLGPCNFSPPPLLRKLELHGRIRVMPDSFRNLKQLRKIFLRLSELDGRAIEILGT LPNLMLLNLDGRAYVGNELAFKKHEFPNLKELRISMLSELRGIRFEKDALPHMERMEI ECCQLRSGIVGIKHLEQLNEISLGCDVAGLDLLEQEVKAHPKTPALRLLQDRSKIDLG LPVVLTKDEGSNVEEEAKESVHDDAGESSQVISSP</aaseq>|
| |
| − | DNA = <dnaseqindica>997..3904#1..116#atggcggagacggcgctgagcatggcgaggtccatgctggggggcgccatcagcgcggcttcggcggccgccggcgaagagatgagcttgctcatgggtgtgcagaaggagatatggtgagtgcgtgtgtactgtgtccccatttgattagtactggtttcttacttccttctgtttaattagttcccttaaagaaagaggcgtttcaaagaaagctaattgcatggttattctcgaacagcgatatttcgttcttgctgaccatgcagtgacggagctgcttttcgagtctgggataaacttaaatttattacagtttgctacaagatttttaattttaattaattctttttttttaaaaaaaaataaatcaatcatgtatttgacggtgagcctaggcgatggctctgccccttttacatgtgaatttggacatgtataaagtacagatattgatccatttattgatctatttaaaacctaacgcatcatataatgtgaaaatgcatggggaaagtataatatttcatttatcactgtgatcaaatccatctctccgcaaaaaaaaaagataattaattcatcagatttcatccgtgagcaatccatttagatctcattctactttatttgttataattaaagagatgtgatatgagtccacatggtaagggtatcaatgggaaatatactccctgatgtacatggcatgttttgtcatctccgttgtcattgctccatgatttgagaaaattcgtttgaagtttgtactcttaaaatttcaaacatcatctttttgagatatttttacatgcatatataggacctaggcatgtagaggtagaaaaatacgctgagtcacaatacctttaataattcttctaatctgaattaataaaacaagaatttagacttccagagcaaaatcagttattcggaattccatatactcaagagtgctaaattttgttttaccactgtttttttttttggcaggttcatgaatgatgagctaaaaacaatgcaagcgttcctaatagctgctgaaacaatgaagaagaaggacctgctgttgaaggtgtgggctgagcaagtaaggagcttgtcctacgacattgaagattgtcttgaagagtttatggtccatgtcggaaaccaaagcctcttgcagcaattgacaaatctcaaagatcgccaccgaatagctgtcaagattcgcaacctcaaatcaagacttgaagaagtgagcagcagaaacacacgttacaactcgatcaagatggaggcgaacaacaccttcgatgagatcgagtccatggaggatgttcggaatcattctcgtagcaacatcgacgaagcaaagcttgtaggctttgacacccccaaaaaggagttacttgacaagataaacatggatgccaatgatgatgaccactgtcgggtgctttgtgtggttggcatgggaggattgggtaagactactctggtaaggaagatctttgaaagtaaggaagacatcataaataattttccacatcgtgcttggatcgttgtgtcacagtcattttcgatgatagagatgctcaaagatatgattagccaacttctaggtcatgaatcattgaaaagatttgaagggaagccgatccgagcacacgaccttggtacgcacctacgagatggactgaaagaattgaggtactttgttgtttttgatgacttgtggaacacagatcactgggaatggattagggaatttgctttgcctagtaaaaacaacaaaaggagtcgggtgattgtaacaaccagattagatggagtagctaatgcatgcaccactgaaccatttgtctaccgccttaagctcctagagacggaatgtgccatagatttgctactaaggaagatgggggaaagtaaagaagatatgaagaatgataacaacctgaagagcatagttacacaattagtaaaaaagtgtggttgtttaccactagccatagtaacgataggagcaatgtttgctaataaaccttcgtcgaagtgggaagaaatgtgcagacaacttccttcagagcttgagaacaacccaagccctggagtcgaagcaataaggagggtggtgaccctaagctatggccatttgccatctcatcttaaaccatgctatctatatctaagcatttttcctgaggatattgaaattaaaaggaggcatttggtaaacagatgggtagcggaggggttggttagagctagagttggaatgaccattagtgatgtcggagaaagctactttgatgagctaattagccgaagtatgattcaaccatcaagggtgaatatggaaggacatgttaagagctgccgggtccatgatataatgcgtgatattatagtctcaatttctaaagaggagaattttgtttactcaacaggagataatgtatctacagtaatagtggagaagttccgtcatctgtcatgccatggcggcaactacccaatagttggaatggatttcagtcgtgtccgatcgttaactgtatttggtgagtttgatcagagacccatgttggtgggctcttcaatttgttcagctcaattcacgatgctaagagtcttggatctagagaatgcagtattttcagtgacacaaaaagacataaacaaaattgggttgttgcggcacttgagatatttgaatacgcatactagaagacggtccactatttatgcacttccaagctctatcgggaaattacagaacttacaagttttggacataagagagagtgaaatttctacactaccaactgatatcagtaagctccttatgcttcgtatcctccgttgtagcaagggaccgtggtacttctacttctattttgatccagatgaaccaataaaatgcttgaagcatacgttgcgcatgcccttgatgttgacaccattagttggttctgcagcacgcaattatactattgctgagctacacagggcctactctagccattggtcagagacaccaggcgtgagggttccaacaggaatcagcaaactaaaggagttgcaggtcttagaggttgtagaccttaaactaactaaaagcaaagcaattgaagagctgggtgaacttcgctggctacaaaaattacgggtgtcaacaaagggggcccaggacaagaagcgcaagacactttgtgaagccatcgagaagctatcatccctccaatctctctgtgtttatgagggttactacttcataactgggacacttgagtggctgggtccttgcaatttctcccctcctcccctgctgagaaagctagagttgcatggacgtattcgcgtgatgcccgactcttttaggaaccttaagcagctgcggaagatttttttgcggctaagcgaactagatggtagagccatagagatacttggaacactacccaacctcatgctcctgaatctcgatggcagagcatatgttgggaatgaattagcattcaaaaagcacgagttcccaaatctcaaggagcttcgtatcagtatgctgtccgaactaagagggataagatttgagaaggacgccttgccccacatggaaagaatggaaatcgaatgttgccagttgagatcagggattgttggcatcaagcacctcgaacagctcaacgagatttcacttgggtgtgatgtggcggggcttgatctgctggaacaggaagtaaaggcgcaccccaagacacccgcattgcggctgcttcaagaccgaagcaaaatcgacttggggctccctgtagtcctgacgaaagacgaaggctccaatgttgaagaggaagcaaaggaatccgtccatgacgatgccggggagagctcgcaagtgatctcatcaccgtga</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063182.1 RefSeq:Os06g0125000]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
Os06g0125000 is a protein-coding gene. The protein Os06g0125000 translated share most of it's amino acid sequence(Query Cover: 99%) with one kind of plants' disease resistance protein which is coding by bacterial resistance gene Resistance to Pseudomonas syringae pv. maculicola 1 (RPM1).
The disease resistance protein which RPM1 translated is cytoplasmic localized receptor-like protein, it enable detection of numerous microbial effector proteins, which have been released within the host cell and have specific functions which collectively suppress defense and/or reconfigure host metabolism to nourish pathogen growth. The suite of pathogen effectors varies considerably among pathogens, with bacterial pathogens capable of delivering tens of effectors, whereas fungi and oomycetes are predicted to deliver hundreds of effectors.
Expression
The bacterial resistance gene Resistance to Pseudomonas syringae pv. maculicola 1 (RPM1), encodes a classic cytoplasmic receptor-like protein that is characterized by an amino terminal coiled-coil domain, a central nucleotide binding (NB) site and a carboxyl terminal LRR domain. RPM1 was one of the first plant resistance genes to be molecularly described from studies of natural variation in Arabidopsis thaliana (Grant et al., 1995). Moreover, RPM1 was the first example of a dual specificity R-protein, recognizing the sequence-unrelated AvrB and AvrRpm1 effector proteins derived from bacterial pathogens of soybean and Brassica species, respectively (Bisgrove et al., 1994). Actual dual specificity recognition is through effector-mediated modifications of RPM1- interacting protein 4 (RIN4) in the presence of the bacterial type III effector proteins AvrRpm1 or AvrB (Mackey et al., 2002).
Evolution
The RPM1 gene was shown to have originated prior to split between the ancestors of the Brassica and Arabidopsis lineages because a single homologous copy was found at two of six homol- ogous loci in Brassica napus, a cultivated polyploid relative of A. thaliana (Grant et al., 1998). Susceptibility to bacteria expressing AvrRpm1 has previously only been observed as a complete deletion of the coding sequence, replaced by a much shorter fragment of unknown origin in susceptible A. thaliana plants, with similar but independent RPM1-deletions in two of the four rpm1-null loci of B. napus (Grant et al., 1998).
Labs working on this gene
nstitute of Population Genetics, Heinrich-Heine Universität, Düsseldorf, Germany
MolecularandComputationalBiology,UniversityofSouthernCalifornia,LosAngeles,CA,USA
School of Biosciences, University of Exeter, Exeter, UK
SchoolofLifeSciences,UniversityofWarwick,Wellesbourne,UK
References
1. Grant, M. R., Godiard, L., Straube, E., Ashfield, T., Lewald, J., Sattler, A., et al. (1995). Structure of the Arabidopsis Rpm1 gene enabling dual- specificity disease resistance. Science 269, 843–846.
2. Bisgrove, S. R., Simonich, M. T., Smith, N. M., Sattler, A., and Innes, R. W. (1994). A disease resistance gene in Arabidopsis with specificity for 2 different pathogen avirulence genes. Plant Cell 6, 927–933.
3. Mackey, D., Holt, B. F., Wiig, A., and Dangl, J. L. (2002). Rin4 interacts with Pseudomonas syringae type III effector molecules and is required for RPM1-mediated resistance in Arabidopsis. Cell 108, 743–754.
4. Grant, M. R., McDowell, J. M., Sharpe, A. G., Zabala, M. D. T., Lydiate, D. J., Dangl, J. L., et al. (1998). Independent deletions of a pathogen- resistance gene in Brassica and Arabidopsis. Proc. Natl. Acad. Sci. U.S.A. 95, 15843–15848.
Structured Information