Difference between revisions of "Os06g0194900"

From RiceWiki
Jump to: navigation, search
(Expression)
(Structured Information)
 
(13 intermediate revisions by one other user not shown)
Line 4: Line 4:
 
===Function===
 
===Function===
 
In rice three genes encoding for sucrose synthase (Sus),six genes comprise the entire rice ''Sus'' gene family.The six SUS genes can be classified into three recognized Sus groups, the Sus1 group (SUS1, 2and3),the SusA group (SUS4) and the NG (SUS5 and 6), It has been reported that sugar metabolism of rice seedlings is affected by hypoxia typically caused by submergence, and that Sus activity is suggested to be one of the key factors for the altered sugar metabolism in rice plants under submerged condition. overall ''Sus'' activity and expression of ''SUS''2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress.Sucrose is cleaved ''in vivo'' either by sucrose synthase (Sus) (UDP-glucose: D-fructose 2-glucosyl-transferase, EC 2.4.1.13) or by invertase. Sus catalyzes the reversible conversion of sucrose and UDP into UDP-glucose and fructose. There is considerable evidence to indicate that Sus plays a major role(s) in metabolism in a number of different growth processes within a variety of sink tissues.Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme.<ref name="ref1"/>Recently a growing body of evidence suggests that one of the major roles of Sus is to channel UDP-glucose to the synthesis of cell-wall polysaccharides such as cellulose<ref name="ref3"/>
 
In rice three genes encoding for sucrose synthase (Sus),six genes comprise the entire rice ''Sus'' gene family.The six SUS genes can be classified into three recognized Sus groups, the Sus1 group (SUS1, 2and3),the SusA group (SUS4) and the NG (SUS5 and 6), It has been reported that sugar metabolism of rice seedlings is affected by hypoxia typically caused by submergence, and that Sus activity is suggested to be one of the key factors for the altered sugar metabolism in rice plants under submerged condition. overall ''Sus'' activity and expression of ''SUS''2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress.Sucrose is cleaved ''in vivo'' either by sucrose synthase (Sus) (UDP-glucose: D-fructose 2-glucosyl-transferase, EC 2.4.1.13) or by invertase. Sus catalyzes the reversible conversion of sucrose and UDP into UDP-glucose and fructose. There is considerable evidence to indicate that Sus plays a major role(s) in metabolism in a number of different growth processes within a variety of sink tissues.Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme.<ref name="ref1"/>Recently a growing body of evidence suggests that one of the major roles of Sus is to channel UDP-glucose to the synthesis of cell-wall polysaccharides such as cellulose<ref name="ref3"/>
 
===Mutation===
 
  
 
===Expression===
 
===Expression===
Line 26: Line 24:
  
 
* ''SUS2'' was in the phloem in addition to the mesophyll, RSuS2 was evenly distributed in seed tissues other than the endosperm, RSus2 is ubiquitously expressed,may play a house keeping role in providing sucrose to the sink tissues in general.<ref name="ref4" />
 
* ''SUS2'' was in the phloem in addition to the mesophyll, RSuS2 was evenly distributed in seed tissues other than the endosperm, RSus2 is ubiquitously expressed,may play a house keeping role in providing sucrose to the sink tissues in general.<ref name="ref4" />
* the expression of RSus2 requires newly synthesized proteins induced by sucrose and/or starvation. RSus2 may have an important biological function in rice cells other than as a housekeeping gene.<ref name="ref5" />
+
* the expression of ''RSus2'' requires newly synthesized proteins induced by sucrose and/or starvation. RSus2 may have an important biological function in rice cells other than as a housekeeping gene.<ref name="ref5" />
 +
*The transcription rates of ''RSus2'' were similar in cells grown in the sucrose-free and sucrose-containing media, suggesting that there was constitutive expression of ''RSus2'' mRNA in cells under vary-ing sugar availability.<ref name="ref5" />
  
 
===Evolution===
 
===Evolution===
 
the evolution of multiple SS genes is not for the need of diversified catalytic functions but to meet the differential temporal and spatial requirements of the catalytic function according to the scheme of plant development and in response to environmental changes.this trend may be especially enhanced in the rice where the plant must adapt to the aerobic( leaf,stem,and grain) and anaerobic (root) conditions simultaneously and accumulate starch in a short period of the life span.<ref name="ref1" />
 
the evolution of multiple SS genes is not for the need of diversified catalytic functions but to meet the differential temporal and spatial requirements of the catalytic function according to the scheme of plant development and in response to environmental changes.this trend may be especially enhanced in the rice where the plant must adapt to the aerobic( leaf,stem,and grain) and anaerobic (root) conditions simultaneously and accumulate starch in a short period of the life span.<ref name="ref1" />
Sequence similarities in SUS proteins from rice and maize indicate that RSus2 is closely related to maize Sus as is RSUSl to Sh1.The amino acid sequences deduced from RSUS2 and RSUS3 share an 89.6%identity.The set wo genes maybe evolved from the same ancestor after the divergence of RSUSl.
+
Sequence similarities in SUS proteins from rice and maize indicate that ''RSus2'' is closely related to maize Sus as is ''RSUSl'' to ''Sh1''.The amino acid sequences deduced from ''RSUS2'' and ''RSUS3'' share an 89.6% identity.The set two genes maybe evolved from the same ancestor after the divergence of ''RSUSl''.the evolutionary sequences of the three genes as following:
 +
[[File:Three gene phylogenetic tree.png]]
 +
 
 +
the ancestral gene for genes 1 and 3 is given number 3 because it is considered to have 15 introns like gene 2, in other words, the 14 intron structure of gene1 is derived from a 15 intron structure by gene contraction. the isozymes so far isolated from the rice show little differences in their catalytic properties. the SS genes evolved in the plant kingdom at a very early stage. probably immediately following the evolution of sucrose-oriented photosynthetic carbon assimilation system.
 +
 
 +
===Comparison between ''SUS1'' & ''SUS2''===
 +
''RSus1'',is upregulated by sugars. However,''RSus2'', the Sh1-type gene, is sugar as well as starvation upregulated. Possession by the same gene of a similar response to the two contrasting carbohydrate levels is unusual, this is the first case among Sus genes.Sucrose-modulated expression of ''RSus1'' was regulated at the transcriptional level as revealed from that the transcription activity of RSus1 significantly increased in the presence of sucrose , but the stability of the transcribed ''RSus1'' mRNA was not affected by sucrose abundance . However,
 +
there are other mechanisms involved in regulating RSus1 expression. the RSuS1 proteins are extremely stable in sucrose-starved cells. the gene products of RSus1 and RSus2 formed homo- and hetero-tetrameric RSuS isoforms in etiolated rice seedlings. RSuS1 might be stabilized through the formation of heterotetramers with RSuS2 since the RSus2 gene was expressed under sucrose starvation conditions, and the RSuS2 protein level was even higher in sucrose-starved cells than in sucrose-fed cells. Regulation of RSus2 was different from that of RSus1. First, the stability of RSus2 mRNA was higher in sucrose-starved cells, suggesting that post-transcriptional regulation of RSus2 occurred. Second, although the transcriptional activity of RSus2 in sucrose-fed and sucrose-starved cells was similar, the transcription and/or the stability of RSus2 mRNA, was negatively affected by CHX. newly synthesized proteins induced by sucrose or by sucrose starvation were involved in the regulation of RSus2 expression at transcriptional and/or post-transcriptional levels. Furthermore, the changes in mRNA level and those in protein level did not show marked differences, except that the level of RSuS2 protein was higher under prolonged sucrose starvation conditions. However, it may attribute to the higher stability of the RSus2 mRNA in sucrose-starved cells.<ref name="ref5" />
  
===Knowledge Extention===
+
==Knowledge Extention==
 
* sucrose synthase (SS) genes in Populus expression patterns were constitutive and partially overlapping but diverse.
 
* sucrose synthase (SS) genes in Populus expression patterns were constitutive and partially overlapping but diverse.
 +
* In maize, the genes encoding for SuS, ''Sus1'' and ''Sh1'',show contrasting carbohydrate responses; that is,''Sus1'' is upregulated while ''Sh1'' is downregulated in the presence of abundant carbohydrate supplies.<ref name="ref5" />
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 42: Line 49:
 
==References==
 
==References==
 
<references>
 
<references>
<ref name="ref1"> Ju-Wei HUANG;Jen-Tao CHEN;Wei-Ping YU;Lie-Fen SHYUR;Ai-Yu WANG;Hsien-Yi SUNG;Ping-Du LEE;Jong-Ching Su
+
<ref name="ref1"> Ju-Wei HUANG;Jen-Tao CHEN;Wei-Ping YU;Lie-Fen SHYUR;Ai-Yu WANG;Hsien-Yi SUNG;Ping-Du LEE;Jong-Ching Su,
   Complete Structures of Three Rice Sucrose Synthase Isogenes and Differential Regulation of Their Expressions
+
   Complete Structures of Three Rice Sucrose Synthase Isogenes and Differential Regulation of Their Expressions Bioscience, Biotechnology, and Biochemistry, 1996, 60(2): 233-239.</ref>
  Bioscience, Biotechnology, and Biochemistry, 1996, 60(2): 233-239.</ref>
 
 
<ref name="ref2"> Tatsuro Hirose;Graham N. Scofield;Tomio Terao An expression analysis profile for the entire sucrose synthase gene family in rice
 
<ref name="ref2"> Tatsuro Hirose;Graham N. Scofield;Tomio Terao An expression analysis profile for the entire sucrose synthase gene family in rice
 
   Plant Science, 2008, 174(5): 534-543.</ref>
 
   Plant Science, 2008, 174(5): 534-543.</ref>
Line 55: Line 61:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0194900|
 
Description = Sucrose synthase 2 (EC 2.4.1.13)|
 
Version = NM_001063582.1 GI:115466895 GeneID:4340386|
 
Length = 5882 bp|
 
Definition = Oryza sativa Japonica Group Os06g0194900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:4795629..4801510|
 
CDS = 4795896..4795943,4796041..4796179,4796291..4796535,4796666..4796984,4797324..4797548<br>,4797637..4797803,4797886..4798002,4798087..4798260,4798357..4798452<br>,4798535..4798751,4798847..4798965,4799115..4799307,4799391..4799542<br>,4799632..4799752,4800164..4800258|
 
GCID = <gbrowseImage1>
 
name=NC_008399:4795629..4801510
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:4795629..4801510
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctgccaagctagctcgcctccacagtctccgcgaacgcctcggtgccaccttctcgtctcatcccaatgagttgattgcactcttctctaggtatgttaaccagggaaagggaatgctccagcgtcaccagctgcttgcggagttcgatgccttgatcgaagctgacaaagagaaatatgctccctttgaagacattctccgggctgctcaggaagccattgtgctgccgccctgggttgcactggccatcaggccaaggcctggtgtctgggactacattcgggtgaatgtaagtgagttggcagtggaagagctgagtgtttctgagtacttggcattcaaggaacagcttgttgatggacacaccaacagcaactttgttcttgagcttgattttgagcccttcaatgcctccttcccgcgcccgtccatgtccaagtccatcggaaatggggtgcagttccttaaccgtcacctgtcgtccaagttgttccaggacaaggagagcctctaccccttgctgaacttcctgaaagcccataaccacaagggcacgacaatgatgctgaatgacagaattcagagccttcgtgggctccaatcatcccttagaaaggcagaagaatatctgatgggcattcctcaagacacgccctactcggagttcaaccacaggttccaagagctcggtttggagaagggttggggtgactgtgcaaagcgtgtgcttgacaccatccacttgcttcttgaccttcttgaggcccctgatccggccaacttggagaagttccttggaactattccaatgatgttcaatgttgttatcctgtctccgcatggatactttgcccaatccaatgtgttgggataccctgatactggtggtcaggttgtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcagcaaggccttgatatcacacctaagatcctcattgtaaccaggctgttgcctgatgctgttggtactacatgcggccagcgtgtggagaaggttattggaactgagcacactgacattcttcgtgttccattcaggagtgagaatggtatcctccgcaagtggatctcccgttttgatgtctggccattcctggaaacatacactgaggatgttgcaaacgaaattatgagggaaatgcaagccaaacctgatctcatcattggcaattacagtgatggaaaccttgttgccactctgctggctcacaaattaggagttacccagtgtaccattgctcatgccttggagaaaaccaaataccccaactcagacatatacttggacaagtttgacagccagtaccacttctcatgccaattcactgctgatcttatcgccatgaatcacactgatttcatcatcaccagtacattccaagaaattgctggaagcaaggacactgtggggcagtatgaatcacacattgcattcacccttcctgggctttaccgagttgtgcatggcatagatgtttttgatcccaagttcaacattgtctctcctggagctgacatgagtgtctacttcccgtacaccgaggctgacaagaggctcactgctttccaccctgaaattgaggagcttctctacagtgaagtcgagaacgatgaacacaagtttgtattgaaggacaagaacaagccaatcatcttctccatggctcgtcttgaccgagtgaagaacatgacaggtctggttgagatgtatggtaagaatgcacatctcagggatttggcaaaccttgtgattgtttgtggtgaccacggcaatcagtccaaggacagggaggagcaggctgagttcaagaagatgtacggtctcattgaccagtacaagttgaaggggcatatccgctggatctcagctcagatgaaccgtgttcgtaacggggagttgtaccgatacatttgtgacaccaagggagtctttgtccagcctgcattctatgaagcgtttggtctgactgtcatcgaagccatgacatgtggtttgccaacaatcgcaacatgccatggtggccctgctgagattattgttgatggggtgtctggtctgcacattgatccttaccacagtgacaaggctgctgatatcttggtcaacttctttgagaagtgcaagcaggattcaacctactgggacaatatttcacagggaggtctgcagaggatttacgagaagtacacctggaagctgtactctgagaggctgatgaccttgactggtgtatacggattctggaagtacgtaagcaaccttgagaggcgcgagactcgccgttacattgagatgttctatgctctgaaataccgcagcctggccagcgccgtcccattggctgtcgatggagagagcacatccaagtaa</cdnaseq>|
 
AA = <aaseq>MAAKLARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRH                    QLLAEFDALIEADKEKYAPFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSEL                    AVEELSVSEYLAFKEQLVDGHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRH                    LSSKLFQDKESLYPLLNFLKAHNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQD                    TPYSEFNHRFQELGLEKGWGDCAKRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNV                    VILSPHGYFAQSNVLGYPDTGGQVVYILDQVRALENEMLLRIKQQGLDITPKILIVTR                    LLPDAVGTTCGQRVEKVIGTEHTDILRVPFRSENGILRKWISRFDVWPFLETYTEDVA                    NEIMREMQAKPDLIIGNYSDGNLVATLLAHKLGVTQCTIAHALEKTKYPNSDIYLDKF                    DSQYHFSCQFTADLIAMNHTDFIITSTFQEIAGSKDTVGQYESHIAFTLPGLYRVVHG                    IDVFDPKFNIVSPGADMSVYFPYTEADKRLTAFHPEIEELLYSEVENDEHKFVLKDKN                    KPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLANLVIVCGDHGNQSKDREEQAEFKKM                    YGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTKGVFVQPAFYEAFGLTVIEAMTC                    GLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFEKCKQDSTYWDNISQGG                    LQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASAVP                    LAVDGESTSK</aaseq>|
 
DNA = <dnaseqindica>5568..5615#5332..5470#4976..5220#4527..4845#3963..4187#3708..3874#3509..3625#3251..3424#3059..3154#2760..2976#2546..2664#2204..2396#1969..2120#1759..1879#1253..1347#aactatttattggtccttctggatctcggagaaaccctccattcgtttgctcgtctctgaccaccattgggtatgttgcttccattgccaaactgttcccttttacccataggctgattgatcttggctgtgtgattttttgcttgggtttttgagctgattcagcggcgcttgcagcctcttgatcgtggtcttggctcgcccatttcttgcgattctttggtgggtcgtcagctgaatcttgcaggagtttttgctgacatgttcttgggtttactgctttcggtaaatctgaaccaagaggggggtttctgctgcagtttagtgggtttactatgagcggattcggggtttcgaggaaaaccggcaaaaaacctcaaatcctcgacctttagttttgctgccacgttgctccgccccattgcagagttctttttgcccccaaatttttttttacttggtgcagtaagaatcgcgcctcagtgattttctcgactcgtagtccgttgatactgtgtcttgcttatcacttgttctgcttaatcttttttgcttcctgaggaatgtcttggtgcctgtcggtggatggcgaaccaaaaatgaagggttttttttttttgaactgagaaaaatctttgggtttttggttggattctttcatggagtcgcgaccttccgtattcttctctttgatctccccgcttgcggattcataatattcggaacttcatgttggctctgcttaatctgtagccaaatcttcatatctccagggatctttcgctctgtcctatcggatttaggaattaggatctaactggtgctaatactaaagggtaatttggaaccatgccattataattttgcaaagtttgagatatgccatcggtatctcaatgatacttactaaaacccaacaaatccatttgataaagctggttcttttatccctttgaaaacattgtcagagtatattggttcaggttgatttattttgaatcagtactcgcactctgcttcgtaaaccatagatgctttcagttgtgtagatgaaacagctgtttttagttatgttttgatcttccaatgcttttgtgtgatgttattagtgttgatttagcatggctttcctgttcagagatagtcttgcaatgcttagtgatggctgttgactaattattcttgtgcaagtgagtggttttggtacgtgttgctaagtgtaacctttctttgcagttcctgaaattgagtcatggctgccaagctagctcgcctccacagtctccgcgaacgcctcggtgccaccttctcgtctcatcccaatgagttgattgcactcttctctaggtgaagatctcaatataatatcttgtgtcttcttggaacctgctactaattgttttgagttttcaatgattttatccatacagttggttagttcttagtcaacccagatgtgaaacgataacatgttagtatgttacaaattcttagctgacaaggttatgcatctctttagttttaatgatggtatctataataatctgtgatgagctctaacatttttgtcttgagtcatgaatcttagatgatgttgaaatattgtttgttcatagctagattaagtacagatcatgtggtcttaaaaataagaagtaaaaatcaggtttatgtggtagtgccattaacatagttcagccgcagaaaggatgtgagatctaagcattggttctatttcttaaatatcactctatgcaggtatgttaaccagggaaagggaatgctccagcgtcaccagctgcttgcggagttcgatgccttgatcgaagctgacaaagagaaatatgctccctttgaagacattctccgggctgctcaggtaaatttggcaatgagccaggatggttatgatagtcaactcaaagtcaaataccagtctttctaacttacttccttgactgtatgtaggaagccattgtgctgccgccctgggttgcactggccatcaggccaaggcctggtgtctgggactacattcgggtgaatgtaagtgagttggcagtggaagagctgagtgtttctgagtacttggcattcaaggaacagcttgttgatggacagtaagtaccagaacgacgatttgcagattataactgaagcaaaataacagtgactgaattttacttctgtttttcttaaacagcaccaacagcaactttgttcttgagcttgattttgagcccttcaatgcctccttcccgcgcccgtccatgtccaagtccatcggaaatggggtgcagttccttaaccgtcacctgtcgtccaagttgttccaggacaaggagagcctctaccccttgctgaacttcctgaaagcccataaccacaagggcacggtaagcttccaatttgtggaacataccaaatgcttttatactagatgttttttcttgtgtgaattgctttaaatgttagtcctttagaaacccacttgacattctctgtaagttccaccaaatgacgggatccgaattttctattacagacaatgatgctgaatgacagaattcagagccttcgtgggctccaatcatcccttagaaaggcagaagaatatctgatgggcattcctcaagacacgccctactcggagttcaaccacaggtgattactttattatttctccttatcatatagcccatgttatactactgcaaatggaataattccttacaatgtgattcatgatttgaatacaggttccaagagctcggtttggagaagggttggggtgactgtgcaaagcgtgtgcttgacaccatccacttgcttcttgaccttcttgaggcccctgatccggccaacttggagaagttccttggaactattccaatgatgttcaatgttgttatcctgtctccgcatggatactttgcccaatccaatgtgttgggataccctgatactggtggtcaggtagagctttttaacaaattttccccttatatacagtacttcaaatatttctagttttgacctgttattctgttgtttgcaggttgtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcagcaaggccttgatatcacacctaagatcctcattgtatgttcaagatgttggtcttgaatgtttcaagttttaaacacttctcagtgcgaattgtagagtaacgtgcggacatgattttacttgatgcaggtaaccaggctgttgcctgatgctgttggtactacatgcggccagcgtgtggagaaggttattggaactgagcacactgacattcttcgtgttccattcaggagtgagaatggtatcctccgcaagtggatctcccgttttgatgtctggccattcctggaaacatacactgaggtaaatggtttatctgacaacgtccttcagagctgagcacaaaccatgaattctgagagctcatctttttttttttggttgcaggatgttgcaaacgaaattatgagggaaatgcaagccaaacctgatctcatcattggcaattacagtgatggaaaccttgttgccactctgctggctcacaaattaggagttacccaggtatgtttggttgtaaaccactcctttaaatatttctttcattaagtcaattacttatgatttctcttctacatggatacagtgtaccattgctcatgccttggagaaaaccaaataccccaactcagacatatacttggacaagtttgacagccagtaccacttctcatgccaattcactgctgatcttatcgccatgaatcacactgatttcatcatcaccagtacattccaagaaattgctggaaggtaaaattttctaaagagcagtagaatattgctgcgttgtgccaacacctaaacgggtatctgatgtttgtttcctctgtttcttcagcaaggacactgtggggcagtatgaatcacacattgcattcacccttcctgggctttaccgagttgtgcatggcatagatgtttttgatcccaagttcaacattgtctctcctggagctgacatgagtgtctacttcccgtacaccgaggctgacaagaggctcactgctttccaccctgaaattgaggagcttctctacagtgaagtcgagaacgatgaacacaagtgagtactgaactgctggttccgtccctgttattcacctaccatgtaacaaataattaaacactgatttgtgtgtttggtctagctttggctcttcagtctactaagtgccatgcactagaactttgtagatttgaactgcaattcttaattttctcactccttagtagaccacaataataattattgtgtctgacccagctagtttacaatagtgacttcaatgcttgttttttccccttgaacaattgtttactttctagcagtggagtttggcatctaaacttgaatacacgctgttcttttttgtgtataaaatgtttatttaatgttctgcaggtttgtattgaaggacaagaacaagccaatcatcttctccatggctcgtcttgaccgagtgaagaacatgacaggtctggttgagatgtatggtaagaatgcacatctcagggatttggcaaaccttgtgattgtttgtggtgaccacggcaatcagtccaaggacagggaggagcaggctgagttcaagaagatgtacggtctcattgaccagtacaagttgaaggggcatatccgctggatctcagctcagatgaaccgtgttcgtaacggggagttgtaccgatacatttgtgacaccaagggagtctttgtccaggtatatacatacgctgtcatattctactgctatatttctattctgagcttccagtagcaaatgatttctactatttgtaaagaacagccttgtgcttgagactaaaactgcttttaaaattgttttttagcctgcattctatgaagcgtttggtctgactgtcatcgaagccatgacatgtggtttgccaacaatcgcaacatgccatggtggccctgctgagattattgttgatggggtgtctggtctgcacattgatccttaccacagtgacaaggctgctgatatcttggtcaacttctttgagaagtgcaagcaggattcaacctactgggacaatatttcacagggaggtctgcagaggatttacgagaagtatgtatttcatgatctgcaaatatataacattttttttttacgattgacatataactgtagaaatcatgtgtccaatctatattgatcctacaaatttggacttgtcaggtacacctggaagctgtactctgagaggctgatgaccttgactggtgtatacggattctggaagtacgtaagcaaccttgagaggcgcgagactcgccgttacattgagatgttctatgctctgaaataccgcagcctggtaagttactctcgctgttcaacagcttgttaatttcagtattattgcactgagcatatctctgaattctgttgctacatttctttgttgaatccaggccagcgccgtcccattggctgtcgatggagagagcacatccaagtaatggaggggaaaatatgcatcttcagcaggagaagccgtcagctgcattcgaatttgataattttctgtagttgtcatttggcatccatgtttgccatggatgtgtactatgtctaaggtttcagtacttttgcgagattttgggcagtgcttgcctcaaataaacgccggttcctggtgtttatcgttcagaattcaatgcaatgttttattgccgcgcttcctcaatctgtcatgttgaatgaccactccctagtgccctactgtt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063582.1 RefSeq:Os06g0194900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:08, 12 June 2015

The rice Os06g0194900 is the second gene of Sus gene family.

Annotated Information

Function

In rice three genes encoding for sucrose synthase (Sus),six genes comprise the entire rice Sus gene family.The six SUS genes can be classified into three recognized Sus groups, the Sus1 group (SUS1, 2and3),the SusA group (SUS4) and the NG (SUS5 and 6), It has been reported that sugar metabolism of rice seedlings is affected by hypoxia typically caused by submergence, and that Sus activity is suggested to be one of the key factors for the altered sugar metabolism in rice plants under submerged condition. overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress.Sucrose is cleaved in vivo either by sucrose synthase (Sus) (UDP-glucose: D-fructose 2-glucosyl-transferase, EC 2.4.1.13) or by invertase. Sus catalyzes the reversible conversion of sucrose and UDP into UDP-glucose and fructose. There is considerable evidence to indicate that Sus plays a major role(s) in metabolism in a number of different growth processes within a variety of sink tissues.Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme.[1]Recently a growing body of evidence suggests that one of the major roles of Sus is to channel UDP-glucose to the synthesis of cell-wall polysaccharides such as cellulose[2]

Expression

Figure1. The transcript levels of the SUS genes in various rice tissues(from reference [3])..jpg

Expression of different Sus genes is spatially and temporally regulated and is differentially modulated in response to anoxia, low temperatures and osmotic stress,the expression of Sus genes is also differentially affected by sugars. Sus transcripts were detected in a wide range of tissues and at different developmental stages, indicating that Sus is involved in numerous and diverse growth processes in the rice plant. SUS2 was shown to be expressed in a wide range of tissues, suggesting that it may perform a number of housekeeping role(s)[3]

Sus gene expression has also been reported to be induced in response to environmental stresses such as hypoxia and cold. Sus is reported to be encoded by multiple genes which have distinct and partially overlapping expression patterns. For example, maize has at least three genes encoding Sus, Sh1, Sus1 and Sus3 .

The mRNA levels for the SUS genes were highest in elongating sink organs such as roots, developing leaf blades and elongating uppermost internodes, with SUS1 and 2 being the isoforms predominantly expressed within these tissues. In contrast to this, SUS transcript levels in the mature leaf blades and leaf sheaths were low. The transcript levels of each SUS gene were plotted individually to examine specific expression patterns (Figure 1).

  • SUS2 transcript levels were higher in root and internode tissue than other tissues examined.In all of the internode segments the transcripts of SUS1 and SUS2 together accounted for most of the SUS transcripts.
  • SUS2 was most highly expressed in the bottom segment and decreased in subsequent segments before a slight increase in the top two segments.Overall SUS2 expression levels were considerably lower than those for SUS1.
  • SUS2 was abundantly expressed in the early stage of the grain filling at 1 and 2 DAF, then increased and reached maximal levels during 5–10 DAF, and decreased thereafter.[3]
  • SUS2 was highly expressed in the developing caryopsis, correlating strongly with the stage of rapid increase in grain dry weight,and for a longer period thanSUS3, which implies that SUS2,along with SUS3 and SUS4, plays an important role in the grain filling process.
  • SUS2 was in the phloem in addition to the mesophyll, RSuS2 was evenly distributed in seed tissues other than the endosperm, RSus2 is ubiquitously expressed,may play a house keeping role in providing sucrose to the sink tissues in general.[4]
  • the expression of RSus2 requires newly synthesized proteins induced by sucrose and/or starvation. RSus2 may have an important biological function in rice cells other than as a housekeeping gene.[5]
  • The transcription rates of RSus2 were similar in cells grown in the sucrose-free and sucrose-containing media, suggesting that there was constitutive expression of RSus2 mRNA in cells under vary-ing sugar availability.[5]

Evolution

the evolution of multiple SS genes is not for the need of diversified catalytic functions but to meet the differential temporal and spatial requirements of the catalytic function according to the scheme of plant development and in response to environmental changes.this trend may be especially enhanced in the rice where the plant must adapt to the aerobic( leaf,stem,and grain) and anaerobic (root) conditions simultaneously and accumulate starch in a short period of the life span.[1] Sequence similarities in SUS proteins from rice and maize indicate that RSus2 is closely related to maize Sus as is RSUSl to Sh1.The amino acid sequences deduced from RSUS2 and RSUS3 share an 89.6% identity.The set two genes maybe evolved from the same ancestor after the divergence of RSUSl.the evolutionary sequences of the three genes as following: Three gene phylogenetic tree.png

the ancestral gene for genes 1 and 3 is given number 3 because it is considered to have 15 introns like gene 2, in other words, the 14 intron structure of gene1 is derived from a 15 intron structure by gene contraction. the isozymes so far isolated from the rice show little differences in their catalytic properties. the SS genes evolved in the plant kingdom at a very early stage. probably immediately following the evolution of sucrose-oriented photosynthetic carbon assimilation system.

Comparison between SUS1 & SUS2

RSus1,is upregulated by sugars. However,RSus2, the Sh1-type gene, is sugar as well as starvation upregulated. Possession by the same gene of a similar response to the two contrasting carbohydrate levels is unusual, this is the first case among Sus genes.Sucrose-modulated expression of RSus1 was regulated at the transcriptional level as revealed from that the transcription activity of RSus1 significantly increased in the presence of sucrose , but the stability of the transcribed RSus1 mRNA was not affected by sucrose abundance . However, there are other mechanisms involved in regulating RSus1 expression. the RSuS1 proteins are extremely stable in sucrose-starved cells. the gene products of RSus1 and RSus2 formed homo- and hetero-tetrameric RSuS isoforms in etiolated rice seedlings. RSuS1 might be stabilized through the formation of heterotetramers with RSuS2 since the RSus2 gene was expressed under sucrose starvation conditions, and the RSuS2 protein level was even higher in sucrose-starved cells than in sucrose-fed cells. Regulation of RSus2 was different from that of RSus1. First, the stability of RSus2 mRNA was higher in sucrose-starved cells, suggesting that post-transcriptional regulation of RSus2 occurred. Second, although the transcriptional activity of RSus2 in sucrose-fed and sucrose-starved cells was similar, the transcription and/or the stability of RSus2 mRNA, was negatively affected by CHX. newly synthesized proteins induced by sucrose or by sucrose starvation were involved in the regulation of RSus2 expression at transcriptional and/or post-transcriptional levels. Furthermore, the changes in mRNA level and those in protein level did not show marked differences, except that the level of RSuS2 protein was higher under prolonged sucrose starvation conditions. However, it may attribute to the higher stability of the RSus2 mRNA in sucrose-starved cells.[5]

Knowledge Extention

  • sucrose synthase (SS) genes in Populus expression patterns were constitutive and partially overlapping but diverse.
  • In maize, the genes encoding for SuS, Sus1 and Sh1,show contrasting carbohydrate responses; that is,Sus1 is upregulated while Sh1 is downregulated in the presence of abundant carbohydrate supplies.[5]

Labs working on this gene

  • National Agricultural Research Center, 1-2-1 Inada, Joetsu, Niigata 943-0193, Japan
  • Department of Agricultural Chemistry, National Taiwan University, Taipei, Taiwan 106, R.O.C
  • Department of Agronomy, National Taiwan University, Taipei, Taiwan 106, R.O.C.

References

  1. 1.0 1.1 Ju-Wei HUANG;Jen-Tao CHEN;Wei-Ping YU;Lie-Fen SHYUR;Ai-Yu WANG;Hsien-Yi SUNG;Ping-Du LEE;Jong-Ching Su, Complete Structures of Three Rice Sucrose Synthase Isogenes and Differential Regulation of Their Expressions Bioscience, Biotechnology, and Biochemistry, 1996, 60(2): 233-239.
  2. C.H. Haigler, M. Ivanova-Datcheva, P.S. Hogan, V.V. Salnikov, S. Hwang, K. Martin, D.P. Delmer, Carbon partitioning to cellulose synthesis, Plant Mol. Biol. 47 (2001) 29–51.
  3. 3.0 3.1 3.2 Tatsuro Hirose;Graham N. Scofield;Tomio Terao An expression analysis profile for the entire sucrose synthase gene family in rice Plant Science, 2008, 174(5): 534-543.
  4. A.Y. Wang, M.H. Kao, W.H. Yang, Y. Sayion, L.F. Liu, P.D. Lee, J.C. Su, Differentially and developmentally regulated expression of three rice sucrose synthase genes, Plant Cell Physiol. 40 (1999) 800–807.
  5. 5.0 5.1 5.2 5.3 Y.C Liao, A.Y Wang Sugar-modulated gene expression of sucrose synthase in suspension-cultured cells of rice.Physiol Plant, 118 (2003), pp. 319–327

Structured Information