Difference between revisions of "Os06g0229800"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Structured Information)
 
(18 intermediate revisions by one other user not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
ALK (alkali degeneration gene) ,located on chromosome 6,previous studies have demonstrated that acl(t), a determinator of the profile for amylopectin chain-length of subspecies Japonica and Indica, alk(t)and SSSIIa were all mapped to the same locus.
 +
 +
[[File:map location.jpg]]
 +
 +
Fig.1. Genetic map of chromosome 6 in rice
 +
 +
This gene,which has been proposed to be involved in the biosynthesis of amylopectin.It is a single copy gene via Southern blot analysis.The product of this gene only have one ORF, which belongs to glycosyl transferase family. Genomic DNA contains seven introns and eight exons. full-length of cDNA is 2409bp,and the enzyme protein composed of 803 amino acids.
 +
 +
[[File:cDNA of alk.jpg]]
 +
 +
Fig.2. Demonstration of genome sequence and cDNA sequence of alk
 +
 
===Function===
 
===Function===
 
ALK gene encodes a soluble starch synthase Ⅱ, controlling the temperature of rice pasting .The encoding amino acid product of  ALK gene may cause a change in starch synthase activity, thus affecting the synthesis of amylopectin branch chain of medium length, so that the crystal layer structure changes, resulting in the final performance of pasting temperature change.
 
ALK gene encodes a soluble starch synthase Ⅱ, controlling the temperature of rice pasting .The encoding amino acid product of  ALK gene may cause a change in starch synthase activity, thus affecting the synthesis of amylopectin branch chain of medium length, so that the crystal layer structure changes, resulting in the final performance of pasting temperature change.
 +
 +
Gelatinization temperature (GT), an important parameter for rice cooking quality, is the critical temperature at which the starch granules start to lose crystallinity and birefringence by irreversible expanding and to change the starch surface from polarized to soluble state called starch paste.
 +
 +
Map-based cloning and sequence analysis of the ALK genes from different rice varieties, and base substitutions in coding sequence may cause the alteration in GT.Comparison between the DNA sequences from different rice varieties, together with the results obtained with digestion of the rice seeds in alkali solution, indicates that the base substitutions in coding sequence of ALK may cause the alteration in GT.
 +
 +
[[File:comparison.jpg]]
 +
 +
Fig.3. Comparison between the conserved DNA fragments of ALK in 9 rice varieties. The different nucleotides are shown inbold. Numbers above the plus sign indicate the nucleotide position fromATG in ALK of Shuangke Zao.
 +
 +
alk cause the differences between a japonica rice variety Nipponbare and an indica rice variety Kasalath in terms of the disintegration of endosperm starch granules in alkali solution and their gelatinization in a 4 M urea solution, respectively, cosegregated in backcross inbred lines derived from a cross between the two varieties[1].
 +
 
===Expression===
 
===Expression===
ALK gene is a single copy gene, and it has a specific expression in the seed of rice,RT-PCR results showed that expression of the gene product is not detected in the blade tissues.
+
ALK gene is a single copy gene, RT-PCR analysis demonstrated that ALK is expressed only in rice seeds,expression of the gene product is not detected in the blade tissues. In addition, no difference was detected at transcriptional level (fig. 5) among the rice varieties with high and low GT, suggesting that the alterations at the SSSII in different rice varieties may mainly affect its enzymatic activities.
 +
 
 +
[[File:expressionRT.jpg]]
 +
 
 +
Fig. 2. (a) Transcriptional levels of predicted ALK in different tissues of several rice varieties. (b) Transcriptional levels of Actin in different tissues of several rice varieties.
  
 
===Evolution===
 
===Evolution===
Line 13: Line 40:
 
[[File:Phylogenetic trees of SSⅡ from 5 different plant species.jpg]]
 
[[File:Phylogenetic trees of SSⅡ from 5 different plant species.jpg]]
  
Figure:Phylogenetic trees of SSⅡ from 5 different plant species(The number values ​​represent the branch length)
+
Fig.4. Phylogenetic trees of SSⅡ from 5 different plant species(The number values ​​represent the branch length)
 +
 
 +
Map-based cloning and sequence analysis of the ALK in different rice varieties revealed that base substitutions of G264 to C264 and GACGAG259-264 to AGCTTA259-264, which cause amino acids changes of Glu88 to Asp88 and Asp87Glu88 to Ser87Leu88, may result in the alteration of enzymatic activity of SSSII, which will finally alter the fine structure of crystalline lamellae of amylopectin and GT of rice.
 +
 
 +
[[File:relationship.jpg]]
 +
 
 +
Fig.5. Relationships between the primary amino acid sequences of SSSII in several plant species. The dendrogram was generated by the program CLUSTAL W. Accession numbers of source sequences are AY133248 for A. tauschii, AF155217 for wheat, AY133250 for barley, AF019296 for maize SSSIIb, AF019297 for maize SSSIIa, and AY423717 for rice.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
 
1、China National Rice Research Institute
 
1、China National Rice Research Institute
 +
 
Gao Zhenyu, Research:  
 
Gao Zhenyu, Research:  
 
(1) rice functional genomics  
 
(1) rice functional genomics  
Line 24: Line 58:
  
 
2、Institute of Crop Science and the National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences
 
2、Institute of Crop Science and the National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences
Jianmin Wan, His group is mainly engaged in rice gene mapping, cloning and cultivar selection.  
+
 
They focus on rice heading date, hybrid sterility, protein trafficking,and other traits which are related in rice important development. (Germination, Plant Height, Panicle development, Starch biosynthesis). The lab also commit themselves to building high-density new molecular marker map, conducting fine mapping of genes related to the new, map-based cloning, conducting genetic transformation and function identification, as well as doing research of rice functional genomics, proteomics and bioinformatics, establishing and improving the design of efficient molecular breeding system, combined with conventional breeding to cultivate new varieties of high-quality rice with powerful market competitiveness.
+
Jianmin Wan, His group is mainly engaged in rice gene mapping, cloning and cultivar selection.They focus on rice heading date, hybrid sterility, protein trafficking,and other traits which are important in rice development. The lab also commit themselves to building high-density new molecular marker map, conducting fine mapping of genes related to the new, map-based cloning, conducting genetic transformation and function identification, as well as doing research of rice functional genomics, proteomics and bioinformatics, establishing and improving the design of efficient molecular breeding system, combined with conventional breeding to cultivate new varieties of high-quality rice with powerful market competitiveness.
 +
 
 +
3、T. Umemoto ,Tohoku National Agricultural Experiment Station, Omagari, Akita 014-0102, Japan
  
 
==References==
 
==References==
1. 高振宇, 曾大力, 崔霞等. 水稻稻米糊化温度控制基因ALK的图位克隆及其序列分析. 中国科学(C辑), 2003, 33(6):481-487.
+
1. Lin SY, Nagamura Y, kurata N, et al.DNA markers tightly linked to genes,Ph,alk and Rc.Rice Genet Newsletter,1994,11:108
 +
 
 +
2. Umemoto, T., et al., Mapping of a gene responsible for the difference in amylopectin structure between japonica-type and indica-type rice  varieties. Theoretical and Applied Genetics, 2002. 104(1): p. 1-8.
 +
 
 +
3. 高振宇, 曾大力, 崔霞等. 水稻稻米糊化温度控制基因ALK的图位克隆及其序列分析. 中国科学(C辑), 2003, 33(6):481-487.
  
2. Guoyu Zhang;Zhijun Cheng;Xin Zhang;Xiuping Guo;Ning Su;Ling Jiang;Long Mao;Jianmin Wan. Double repression of soluble starch synthase genes SSIIa and SSIIIa in rice (Oryza sativa L.) uncovers interactive effects on the physicochemical properties of starch,Genome, 2011, 54(6): 448-459
+
4. Guoyu Zhang;Zhijun Cheng;Xin Zhang;Xiuping Guo;Ning Su;Ling Jiang;Long Mao;Jianmin Wan. Double repression of soluble starch synthase genes SSIIa   and SSIIIa in rice (Oryza sativa L.) uncovers interactive effects on the physicochemical properties of starch,Genome, 2011, 54(6): 448-459
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0229800|
 
Description = Similar to Starch synthase IIA|
 
Version = NM_001063751.1 GI:115467233 GeneID:4340567|
 
Length = 4946 bp|
 
Definition = Oryza sativa Japonica Group Os06g0229800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:6747359..6752304|
 
CDS = 6747562..6747891,6748021..6748689,6748789..6748857,6749547..6749624,6749707..6749817<br>,6749923..6749967,6750384..6750557,6751025..6751981|
 
GCID = <gbrowseImage1>
 
name=NC_008399:6747359..6752304
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:6747359..6752304
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtcgtcggccgtcgtcgcgtcatccaccacgttcctcgtcgcgctcgcctcttcggcgtcacggggagggcccaggagggggagggtggtgggcgtggccgcgccgccggccctgctttacgacggccgcgccggaaggctagccctacgggcgccgcctccgccccggcctcggcctcggcgtcgggatgcgggcgtggtgcgccgcgcggatgatggggagaacgaggcggcggtggagcgggcgggtgaggacgacgacgaggaggaggagttctcttcgggcgcgtggcagccgccccgctcgcgtcgcggcggcgtcggcaaggtcttgaagcggaggggcaccgtcccgcccgtcggccggtacggctccggcggtgatgcggcgagagtgcgcggggcggccgcgccggcgccggcgccgacacaggacgccgcctcaagtaagaacggagcgcttctcagcggccgcgacgacgacacacctgcctcacggaacggatcggtcgttaccggcgccgacaagcctgccgccgccacgccgccggtgaccataacgaagctcccagcgccggactcccccgtgatccttccatccgtagacaagccgcagccggagttcgtcatcccagacgcgacggcgccggcgccgccaccgcccggttcaaatcccaggtcgtccgctcctctccccaagcctgacaattcggaatttgcagaggataagagcgcaaaagttgttgagagtgctccgaagccaaaggcgactagatcttcccctattcctgcggtagaagaggagacgtgggatttcaagaaatattttgatctgaacgaaccggacgccgcggaggatggcgatgacgatgatgactgggctgattcagatgcgtcagattctgagatcgaccaggatgacgattcgggccctttggctggggagaatgtcatgaacgtgatcgtggtggctgctgaatgttctccctggtgcaaaacaggtgggcttggagatgttgcaggtgctttacccaaagctttggcgaggagaggacatcgtgttatggttgtggtaccaaggtacggtgattacgcggaagcccaggatgtaggaatcaggaaatactacaaggctgctggacaggatctggaagtgaaatatttccatgcatttatcgatggagttgattttgtgttcattgacgctcctctcttccgtcaccgtcaggatgacatctatggggggaacagacaggaaatcatgaagcgcatgattctgttttgtaaggctgctgttgaggttccttggcacgttccatgcggtggtgtgccctatggggatggcaacttggtgttccttgcaaacgattggcacactgcactcctgcctgtttatctgaaggcatattacagagacaatggcatgatgcagtacactcgctctgtccttgtgatacataatatcgcttaccagggccgtggcccagtagatgaattcccctacatggaattgccggagcactacctggatcacttcaagctgtacgaccccgtcggcggcgagcacgccaacatcttcggcgcgggcctgaagatggcggaccgggtggtgaccgtgagccccggctacctctgggagctgaagacgacggagggcggctggggcctccacgacatcatacgggagaacgactggaagatgaacggcatcgtgaacggcatcgactaccgggagtggaacccggaggtggacgtgcacctgcagtccgacggctacgccaactacaccgtggcctcgctggactccagcaagccgcggtgcaaggcggcgctgcagcgcgagctggggctggaggtgcgcgacgacgtgccgctgatcgggttcatcgggcggctcgacgggcagaaaggtgtggacatcatcggcgacgcgatgccgtggatcgccgggcaggacgtgcagctggtgctgctgggctccggccgccgcgacctggaggtgatgctgcagcggttcgaggcgcagcacaacagcaaggtgcgcgggtgggtggggttctcggtgaagatggcgcaccggatcacggcgggcgccgacgtgctggtcatgccgtcgcggttcgagccgtgcggcctcaaccagctctacgccatggcgtacggcaccgtccccgtcgtgcacgccgtcggcgggctgagggacaccatgtcggcgttcgacccgttcgaggacaccggcctcgggtggacgttcgaccgcgccgagccgcacaagctcatcgaggcgctcggccactgcctcgagacgtaccgcaagtacaaggagagctggagggggctccaggtgcgcggcatgtcgcaggacctcagctgggaccacgccgccgagctctacgaggaggtccttgtcaaggccaagtaccaatggtga</cdnaseq>|
 
AA = <aaseq>MSSAVVASSTTFLVALASSASRGGPRRGRVVGVAAPPALLYDGR                    AGRLALRAPPPPRPRPRRRDAGVVRRADDGENEAAVERAGEDDDEEEEFSSGAWQPPR                    SRRGGVGKVLKRRGTVPPVGRYGSGGDAARVRGAAAPAPAPTQDAASSKNGALLSGRD                    DDTPASRNGSVVTGADKPAAATPPVTITKLPAPDSPVILPSVDKPQPEFVIPDATAPA                    PPPPGSNPRSSAPLPKPDNSEFAEDKSAKVVESAPKPKATRSSPIPAVEEETWDFKKY                    FDLNEPDAAEDGDDDDDWADSDASDSEIDQDDDSGPLAGENVMNVIVVAAECSPWCKT                    GGLGDVAGALPKALARRGHRVMVVVPRYGDYAEAQDVGIRKYYKAAGQDLEVKYFHAF                    IDGVDFVFIDAPLFRHRQDDIYGGNRQEIMKRMILFCKAAVEVPWHVPCGGVPYGDGN                    LVFLANDWHTALLPVYLKAYYRDNGMMQYTRSVLVIHNIAYQGRGPVDEFPYMELPEH                    YLDHFKLYDPVGGEHANIFGAGLKMADRVVTVSPGYLWELKTTEGGWGLHDIIRENDW                    KMNGIVNGIDYREWNPEVDVHLQSDGYANYTVASLDSSKPRCKAALQRELGLEVRDDV                    PLIGFIGRLDGQKGVDIIGDAMPWIAGQDVQLVLLGSGRRDLEVMLQRFEAQHNSKVR                    GWVGFSVKMAHRITAGADVLVMPSRFEPCGLNQLYAMAYGTVPVVHAVGGLRDTMSAF                    DPFEDTGLGWTFDRAEPHKLIEALGHCLETYRKYKESWRGLQVRGMSQDLSWDHAAEL                    YEEVLVKAKYQW</aaseq>|
 
DNA = <dnaseqindica>204..533#663..1331#1431..1499#2189..2266#2349..2459#2565..2609#3026..3199#3667..4623#gcgcacgctttacaggtggctcccccgccgtctcccccgcgtgccctcctcgccgtcgtcgctcgctgcccatttcatcccccgcacggcacgcgcgggacgaaagcaaagcacgcgcacacactcaaacccgcgcctcctccgctctcgtccgtcgcttcggttcggttccggctcgatcggggaggttcctcggggcgaccatgtcgtcggccgtcgtcgcgtcatccaccacgttcctcgtcgcgctcgcctcttcggcgtcacggggagggcccaggagggggagggtggtgggcgtggccgcgccgccggccctgctttacgacggccgcgccggaaggctagccctacgggcgccgcctccgccccggcctcggcctcggcgtcgggatgcgggcgtggtgcgccgcgcggatgatggggagaacgaggcggcggtggagcgggcgggtgaggacgacgacgaggaggaggagttctcttcgggcgcgtggcagccgccccgctcgcgtcgcggcggcgtcggcaaggtgggttggtggtgtcgatcggggcgccgagatcgtcgtgctcgagaggtgttctctgctttgattcgctttgatgttttcatttgaaaccgacgcgtgtgcttgcgcgtgcgcgcgctgtgtttgcaggtcttgaagcggaggggcaccgtcccgcccgtcggccggtacggctccggcggtgatgcggcgagagtgcgcggggcggccgcgccggcgccggcgccgacacaggacgccgcctcaagtaagaacggagcgcttctcagcggccgcgacgacgacacacctgcctcacggaacggatcggtcgttaccggcgccgacaagcctgccgccgccacgccgccggtgaccataacgaagctcccagcgccggactcccccgtgatccttccatccgtagacaagccgcagccggagttcgtcatcccagacgcgacggcgccggcgccgccaccgcccggttcaaatcccaggtcgtccgctcctctccccaagcctgacaattcggaatttgcagaggataagagcgcaaaagttgttgagagtgctccgaagccaaaggcgactagatcttcccctattcctgcggtagaagaggagacgtgggatttcaagaaatattttgatctgaacgaaccggacgccgcggaggatggcgatgacgatgatgactgggctgattcagatgcgtcagattctgagatcgaccaggatgacgattcgggccctttggctggggagaatgtcatgaacgtgatcgtggtggctgctgaatgttctccctggtgcaaaacaggcatgtacacgatatatacttcttttttctcttttttgttcttctgatcttgtaaatttgcttcagttactgatatgaacaagtgttgcatttgcacaggtgggcttggagatgttgcaggtgctttacccaaagctttggcgaggagaggacatcgtgttatggtattactccttttttctctccttcatggttggatgtttcttccattcttacagatttgatcatttaattaacgtatattttcagatatataaatttggatcaaatgtaaagcagattagttctcttatgttcttttgtttacataatcatgatggcaaattaaaaaggctactccagctgttagattcaaaatacaaaagtaatattgataaatttgcaaatctgtacttgaaagctaaattgcttactattgttacagaaatgttcatttctaacatgctgttgaaaatatatacactatggcgtagccgcttagatcatcacgtggccatggaaactagtgccaaaagtagttctcttagttacactagttacatacctgtacatgataacggatcaggcccatacaattagggatagattaggagcccgttaacgaactaggcccttataattagggagggacggtagttacttttcgcatatggacatgctgcacgtgttgggaggaggggatggaaggaagacgacttcgcttttaagatagtagagaaatgtagcaattttttttagcaattttagttatggtaataatataaaccacaacgtattcagagatcggaaacggggactctcggtgacttcctgatataaactgataactggcaaatgcatctttcaatcttaggttgtggtaccaaggtacggtgattacgcggaagcccaggatgtaggaatcaggaaatactacaaggctgctggacaggtgtgtgtcaacaatgcaatccaagaagactggcataggagacgcaaattccttagtaattggtttttattttggcctgcaggatctggaagtgaaatatttccatgcatttatcgatggagttgattttgtgttcattgacgctcctctcttccgtcaccgtcaggatgacatctatggggggaacagacaggtgaagcttctatctgtttggtattacattgcattagtaaaacttaagttgcatctcctaggcgtactgatttgaaaatgcttacccattcccattttcattcaggaaatcatgaagcgcatgattctgttttgtaaggctgctgttgaggtattttctccaactccattatcaatcattaatttggttttaggaatgagatgtatttgtttggtttgaggattggtcaaaagcacaaatcattttttctgttgataaatagaagaagtgtattaacttttggactgaagcacacaataagtaggagaaatgaggtcgcagtagatgatttgaatttgatccctcaaacaaacagcccgtaaatgtttctgcaagatttcacagagattcatattcttttttattttaaatatattacacattatcgccaaatacacggatgaactccttcgatacctctagcagcatttcaacctgctaccgttcgtaatatgcaatgctcttgccaatgttgtcatatgttcccctacaaagggctatattttctgtttctgtacaatcggcaggttccttggcacgttccatgcggtggtgtgccctatggggatggcaacttggtgttccttgcaaacgattggcacactgcactcctgcctgtttatctgaaggcatattacagagacaatggcatgatgcagtacactcgctctgtccttgtgatacataatatcgcttaccaggttttgtttttctctcctccctaatgaatcatctttattctatttgtatgcatctcctgctgtttgttagagaaattagttgagtgcacaaattgtgggtcatggtaattattgagcagggacacgataaactcttcttcagtctattactacttttagttcagcaatttctccgtttcatattataatttataagtcgttttttttctaatcaaacatctttacgtttgattaactttatcgaaaaatttaacagcatctataacatcaaattagtttaattaaatataatgtttaatgtaatttgattatatgtttgttttgtattggaaatgttattgtatttttctataaactaattaaatttaaaactgtttaacttaaaaaaatatcaaaacaatttacaatatgaaacgggccggggagtactttttttgtgtgctaaatggttcgtgtaatgtttgtagggccgtggcccagtagatgaattcccctacatggaattgccggagcactacctggatcacttcaagctgtacgaccccgtcggcggcgagcacgccaacatcttcggcgcgggcctgaagatggcggaccgggtggtgaccgtgagccccggctacctctgggagctgaagacgacggagggcggctggggcctccacgacatcatacgggagaacgactggaagatgaacggcatcgtgaacggcatcgactaccgggagtggaacccggaggtggacgtgcacctgcagtccgacggctacgccaactacaccgtggcctcgctggactccagcaagccgcggtgcaaggcggcgctgcagcgcgagctggggctggaggtgcgcgacgacgtgccgctgatcgggttcatcgggcggctcgacgggcagaaaggtgtggacatcatcggcgacgcgatgccgtggatcgccgggcaggacgtgcagctggtgctgctgggctccggccgccgcgacctggaggtgatgctgcagcggttcgaggcgcagcacaacagcaaggtgcgcgggtgggtggggttctcggtgaagatggcgcaccggatcacggcgggcgccgacgtgctggtcatgccgtcgcggttcgagccgtgcggcctcaaccagctctacgccatggcgtacggcaccgtccccgtcgtgcacgccgtcggcgggctgagggacaccatgtcggcgttcgacccgttcgaggacaccggcctcgggtggacgttcgaccgcgccgagccgcacaagctcatcgaggcgctcggccactgcctcgagacgtaccgcaagtacaaggagagctggagggggctccaggtgcgcggcatgtcgcaggacctcagctgggaccacgccgccgagctctacgaggaggtccttgtcaaggccaagtaccaatggtgaagagaccatgtccgcccgcggtctccgcctgcgcgttcggcagctatagctatagcctccctgaagaagcttggcgctgctgtggaggtgcgactcggtggcggtgtggcgccggcgccggcgcttgcaggggaggtgtttgtgctgaccgagctgtgcgttgaggtgcgcaaattagcttccggtttgtgtgttcatggcgaggcatggtggagttgagggagtattaagctttgtttcagatgcatcatgcatgcgtaataggatgttgtatttaataatgtgtttgttatgtccattgatgcgatgttacttcttcatta</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063751.1 RefSeq:Os06g0229800]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:11, 12 June 2015

Please input one-sentence summary here.

Annotated Information

ALK (alkali degeneration gene) ,located on chromosome 6,previous studies have demonstrated that acl(t), a determinator of the profile for amylopectin chain-length of subspecies Japonica and Indica, alk(t)and SSSIIa were all mapped to the same locus.

Map location.jpg

Fig.1. Genetic map of chromosome 6 in rice

This gene,which has been proposed to be involved in the biosynthesis of amylopectin.It is a single copy gene via Southern blot analysis.The product of this gene only have one ORF, which belongs to glycosyl transferase family. Genomic DNA contains seven introns and eight exons. full-length of cDNA is 2409bp,and the enzyme protein composed of 803 amino acids.

CDNA of alk.jpg

Fig.2. Demonstration of genome sequence and cDNA sequence of alk

Function

ALK gene encodes a soluble starch synthase Ⅱ, controlling the temperature of rice pasting .The encoding amino acid product of ALK gene may cause a change in starch synthase activity, thus affecting the synthesis of amylopectin branch chain of medium length, so that the crystal layer structure changes, resulting in the final performance of pasting temperature change.

Gelatinization temperature (GT), an important parameter for rice cooking quality, is the critical temperature at which the starch granules start to lose crystallinity and birefringence by irreversible expanding and to change the starch surface from polarized to soluble state called starch paste.

Map-based cloning and sequence analysis of the ALK genes from different rice varieties, and base substitutions in coding sequence may cause the alteration in GT.Comparison between the DNA sequences from different rice varieties, together with the results obtained with digestion of the rice seeds in alkali solution, indicates that the base substitutions in coding sequence of ALK may cause the alteration in GT.

Comparison.jpg

Fig.3. Comparison between the conserved DNA fragments of ALK in 9 rice varieties. The different nucleotides are shown inbold. Numbers above the plus sign indicate the nucleotide position fromATG in ALK of Shuangke Zao.

alk cause the differences between a japonica rice variety Nipponbare and an indica rice variety Kasalath in terms of the disintegration of endosperm starch granules in alkali solution and their gelatinization in a 4 M urea solution, respectively, cosegregated in backcross inbred lines derived from a cross between the two varieties[1].

Expression

ALK gene is a single copy gene, RT-PCR analysis demonstrated that ALK is expressed only in rice seeds,expression of the gene product is not detected in the blade tissues. In addition, no difference was detected at transcriptional level (fig. 5) among the rice varieties with high and low GT, suggesting that the alterations at the SSSII in different rice varieties may mainly affect its enzymatic activities.

ExpressionRT.jpg

Fig. 2. (a) Transcriptional levels of predicted ALK in different tissues of several rice varieties. (b) Transcriptional levels of Actin in different tissues of several rice varieties.

Evolution

According to comparison of genomic DNA sequences among nine rice varieties, S-type varieties: Double Branch early, Minghui 63 and Zhaiyeqing,have G at the 264 site.While in C-type varieties(Ningxia early japonica, Chunjiang 06, No. 6 Nipponbare Yang Rice (indica)),have a C at the 264 site. So, the replace of G264 to C264 cause the amino acid change from Glu to Asp of SSS Ⅱ enzyme protein, which may be the genetic basis leading to pasting temperature change. Study the phylogenesis of five different plants including goats grass, wheat, barley, maize and rice, it shows that rice SSS Ⅱ and SSS Ⅱ a and b of maize is nearer relatively in evolutionary kinship, while is distantly related with goat grass species.

In five different plants: wheat, goat grass species, barley, maize and rice, the phylogenetic tree of SS Ⅱ shows that : SS Ⅱ of rice have a nearer evolutionary kinship with maize SS Ⅱa , which up to 69.8%.However, it have further relationship with barley SS Ⅱ. Phylogenetic trees of SSⅡ from 5 different plant species.jpg

Fig.4. Phylogenetic trees of SSⅡ from 5 different plant species(The number values ​​represent the branch length)

Map-based cloning and sequence analysis of the ALK in different rice varieties revealed that base substitutions of G264 to C264 and GACGAG259-264 to AGCTTA259-264, which cause amino acids changes of Glu88 to Asp88 and Asp87Glu88 to Ser87Leu88, may result in the alteration of enzymatic activity of SSSII, which will finally alter the fine structure of crystalline lamellae of amylopectin and GT of rice.

Relationship.jpg

Fig.5. Relationships between the primary amino acid sequences of SSSII in several plant species. The dendrogram was generated by the program CLUSTAL W. Accession numbers of source sequences are AY133248 for A. tauschii, AF155217 for wheat, AY133250 for barley, AF019296 for maize SSSIIb, AF019297 for maize SSSIIa, and AY423717 for rice.

Labs working on this gene

1、China National Rice Research Institute

Gao Zhenyu, Research: (1) rice functional genomics Genetic characteristics of important agronomic traits in rice, screening mutant libraries and build genetic populations, combined with genomics and transcriptomics gene / QTL mapping and cloning, and conduct functional analysis. (2) Rice Molecular Genetics and Breeding Use of existing genetic resources, gene / QTL polymerization and molecular breeding, creating a new high yield and quality of rice germplasm breeding

2、Institute of Crop Science and the National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences

Jianmin Wan, His group is mainly engaged in rice gene mapping, cloning and cultivar selection.They focus on rice heading date, hybrid sterility, protein trafficking,and other traits which are important in rice development. The lab also commit themselves to building high-density new molecular marker map, conducting fine mapping of genes related to the new, map-based cloning, conducting genetic transformation and function identification, as well as doing research of rice functional genomics, proteomics and bioinformatics, establishing and improving the design of efficient molecular breeding system, combined with conventional breeding to cultivate new varieties of high-quality rice with powerful market competitiveness.

3、T. Umemoto ,Tohoku National Agricultural Experiment Station, Omagari, Akita 014-0102, Japan

References

1. Lin SY, Nagamura Y, kurata N, et al.DNA markers tightly linked to genes,Ph,alk and Rc.Rice Genet Newsletter,1994,11:108

2. Umemoto, T., et al., Mapping of a gene responsible for the difference in amylopectin structure between japonica-type and indica-type rice varieties. Theoretical and Applied Genetics, 2002. 104(1): p. 1-8.

3. 高振宇, 曾大力, 崔霞等. 水稻稻米糊化温度控制基因ALK的图位克隆及其序列分析. 中国科学(C辑), 2003, 33(6):481-487.

4. Guoyu Zhang;Zhijun Cheng;Xin Zhang;Xiuping Guo;Ning Su;Ling Jiang;Long Mao;Jianmin Wan. Double repression of soluble starch synthase genes SSIIa and SSIIIa in rice (Oryza sativa L.) uncovers interactive effects on the physicochemical properties of starch,Genome, 2011, 54(6): 448-459

Structured Information