|
|
| (15 intermediate revisions by 2 users not shown) |
| Line 2: |
Line 2: |
| | ===Function=== | | ===Function=== |
| | This gene is originally derived from the Chinese cultivar Di-Gu,which is found on the sixth chromosome. It is the major gene of pricula oryzae, and it has an significant effect on the leaf resistance of ZB15 rice species to blast fungus. | | This gene is originally derived from the Chinese cultivar Di-Gu,which is found on the sixth chromosome. It is the major gene of pricula oryzae, and it has an significant effect on the leaf resistance of ZB15 rice species to blast fungus. |
| | + | Pi-d2 encodes a receptor-like kinase protein with a predicted extracellular domain of a bulb-type mannose specific binding lectin (B-lectin) and an intracellular serine–threonine kinase domain.(Chen et al., 2006). |
| | + | The Pi-d2 full cDNA encodes a predicted protein of 825 amino acids with an estimated molecular mass of about 90 kDa.The N-terminus of Pi-d2, amino acids 1–32, contains a hydrophobic region with a predicted transit peptide function.(Chen et al., 2006). |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | [[File:11103_2012_9998_MOESM2_ESM.jpg|right|thumb|350px|'''Figure 1.''' ''Pi-d2 is a single copy gene, encoding a length of 825 amino acid transmembrane receptor protein kinases (RLK), the kinase containing a hydrophobic amino terminal signal peptide, B-lectin domain, PAN field and TM domain, the carboxy terminus is a typical serine/threonine kinase domain (STK). Because researchers previously have not found RLK outside B-lectin-containing membrane structure in rice, Pi-d2 belong to the new type of resistance genes, which is due to a difference in the anti-sense single base mutation caused by the disease that the 441th amino acid protein isoleucine (I) mutant protein changes to be a susceptible methionine (M) (Chen et al., 2006).
| + | Pi-d2 is a single copy gene, encoding a length of 825 amino acid transmembrane receptor protein kinases (RLK), the kinase containing a hydrophobic amino terminal signal peptide, B-lectin domain, PAN field and TM domain, the carboxy terminus is a typical serine/threonine kinase domain (STK). Because researchers previously have not found RLK outside B-lectin-containing membrane structure in rice, Pi-d2 belong to the new type of resistance genes, which is due to a difference in the anti-sense single base mutation caused by the disease that the 441th amino acid protein isoleucine (I) mutant protein changes to be a susceptible methionine (M) (Chen et al., 2006).[[File:11103_2012_9998_MOESM1_ESM.jpg|right|thumb]] |
| | + | Pi-d2 was constitutively expressed in the rice variety Digu and not induced after M. grisea strain ZB15 inoculation (Figure 5b,c). Northern analysis also showed that the Pi-d2 gene was constitutively expressed in leaves, roots and stems (Figure 5d).(Chen et al., 2006). |
| | + | Because of its novel extracellular domain, Pi-d2 represents a new class of plant resistance genes(Chen et al., 2006) |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| | Pi-d2 is located on rice chromosome 6 near the centromere region, and connects with RM527 and RM3 chain, the genetic distances is 3.2cM and 3.4cM respectively.(Chen et al., 2004) | | Pi-d2 is located on rice chromosome 6 near the centromere region, and connects with RM527 and RM3 chain, the genetic distances is 3.2cM and 3.4cM respectively.(Chen et al., 2004) |
| | + | All the predicted amino acids from susceptible rice varieties share a common amino acid difference, I441M, relative to the resistant rice Digu. Therefore, the corresponding RLK gene in Digu was identified as a potential candidate of Pi-d2.(Chen et al., 2006) |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | Rice Research institute of Sichuan Agricultural University |
| | | | |
| | ==References== | | ==References== |
| Line 24: |
Line 29: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0494100|
| |
| − | Description = Curculin-like (mannose-binding) lectin domain containing protein|
| |
| | | | |
| − | Version = NM_001064221.1 GI:115468173 GeneID:4341092|
| |
| − | Length = 4488 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0494100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − |
| |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:18037336..18041823|
| |
| − | CDS = 18037639..18040176|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:18037336..18041823
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:18037336..18041823
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgcaaatgtgtggatggttactgaaggttgttcgttgggaaaacttaaattgtgtgcacatggaagctcatggcaatcgtcgcagcagtccaacataccttgttatgctgtggatgatttcggtagctagcctattgataacatgtcgtggcagtatccagaagcaagttctctttccagggttcactgccgcgcaaatggattacattgataacgatgggatatttctgctttctaatggctctgtctttggctttggttttgtcacgagcaatgtctcagacaacacgttctacattcttgcagtggttcacatggccactactaccacagtctggtctgccaatcctaactctcctgtcacccattcagatgacttttttttcgacaaggatggcaatgccttcctgcagtcaggaggaggctccaatgtatgggctgccaatatctccgggaaagggactgccacctctatgcaactactggactctggcaatcttgtagtgcttgggaaagatgcctcttctcctctctggcaaagtttcagccatccgacagacactcttctgtctggtcagaatttcatcgaagggatgacgctgatgagcaagtccaacacagtacagaacatgacctatacacttcagatcaaatctgggaacatgatgttatacgccggcttcgagacacctcaaccatactggtctgcacagcaggatagcaggataattgtcaacaagaacggtgacagcatctactctgcaaacctcagttcagcttcttggtccttctatgatcaatcagggtcccttctatcacaacttgtcatcgcgcaagaaaatgccaatgccacattgtctgctgtccttggtagtgatggattgatagctttctatatgctgcagggtggaaatggcaagagtaaattctcgatcacagttccggcagactcttgtgacatgccagcctactgcagtccttacaccatttgcagtagtgggacaggttgccaatgccctttggccctcggctcgtttgcaaactgcaatcctggtgttacatcagcatgcaaatcgaacgaggagtttccgctggttcaactggatagtggagttggatatgtaggcactaacttcttccctcctgcggctaagacgaaccttacgggttgtaagagtgcctgtacaggcaactgctcttgtgttgctgtgttctttgatcaatcttcaggcaattgtttccttttcaaccagatcggaagcttgcagcacaaaggtgggaatacaactcgtttcgcatcttttatcaaggtatcaagcagaggaaaaggtgggagtgatagtggcagtgggaagcacaataccattattattgtcattatgctcggaactttggctatcataggcgtccttatttatattggtttctggatctacaagaggaagaggcatcctccaccatcacaagacgacgctggttcatcggaagatgatggatttctgcaaacaatatccggagcaccagtgcggttcacttacagggagctccaggatgcgacaagcaacttctgtaacaagcttggtcagggagggtttggatctgtgtatcttggtacactcccagacggcagtcgtattgctgtgaagaagctggagggcataggccaaggaaagaaagagttccgctctgaggtaacgatcattggtagtatccaccacatccatcttgtcaaactccgaggcttttgtactgagggaccacacaggcttcttgcctacgagtacatggcgaatgggtcgctggataagtggattttccattctaaagaagatgatcacctgctcgactgggatacaaggtttaacattgcgcttggaacggcaaagggattggcatacctccatcaggactgcgattcgaagattgtacactgtgacattaagcctgagaatgttctacttgacgacaacttcatcgcaaaggtatctgattttggccttgccaagttgatgaccagggagcagagccatgttttcactacgctcagaggcacgcgcgggtaccttgcacctgagtggctcaccaactatgccatctcagagaagagtgatgtgtacagctacggcatggttttgcttgagataatcggtgggaggaagagctacgatccctcggagatctccgagaaggctcacttcccttcctttgcattcaagaagctggaggaaggcgatcttcaggacatcttcgacgccaagctgaagtacaatgacaaggatgggcgggtcgagaccgcgatcaaggtcgcgctctggtgcatccaggatgatttctaccagagaccatccatgtcaaaggttgtgcagatgctcgaaggcgtctgcgaggtgctccagccaccggtgtcgtcgcagatcgggtacaggctctacgcaaacgccttcaaatcgagcagcgaggaggggacttcatcagggatgtcggactacaacagtgatgctctgctttcagctgtgaggctttctggtcccagatga</cdnaseq>|
| |
| − | AA = <aaseq>MQMCGWLLKVVRWENLNCVHMEAHGNRRSSPTYLVMLWMISVAS LLITCRGSIQKQVLFPGFTAAQMDYIDNDGIFLLSNGSVFGFGFVTSNVSDNTFYILA VVHMATTTTVWSANPNSPVTHSDDFFFDKDGNAFLQSGGGSNVWAANISGKGTATSMQ LLDSGNLVVLGKDASSPLWQSFSHPTDTLLSGQNFIEGMTLMSKSNTVQNMTYTLQIK SGNMMLYAGFETPQPYWSAQQDSRIIVNKNGDSIYSANLSSASWSFYDQSGSLLSQLV IAQENANATLSAVLGSDGLIAFYMLQGGNGKSKFSITVPADSCDMPAYCSPYTICSSG TGCQCPLALGSFANCNPGVTSACKSNEEFPLVQLDSGVGYVGTNFFPPAAKTNLTGCK SACTGNCSCVAVFFDQSSGNCFLFNQIGSLQHKGGNTTRFASFIKVSSRGKGGSDSGS GKHNTIIIVIMLGTLAIIGVLIYIGFWIYKRKRHPPPSQDDAGSSEDDGFLQTISGAP VRFTYRELQDATSNFCNKLGQGGFGSVYLGTLPDGSRIAVKKLEGIGQGKKEFRSEVT IIGSIHHIHLVKLRGFCTEGPHRLLAYEYMANGSLDKWIFHSKEDDHLLDWDTRFNIA LGTAKGLAYLHQDCDSKIVHCDIKPENVLLDDNFIAKVSDFGLAKLMTREQSHVFTTL RGTRGYLAPEWLTNYAISEKSDVYSYGMVLLEIIGGRKSYDPSEISEKAHFPSFAFKK LEEGDLQDIFDAKLKYNDKDGRVETAIKVALWCIQDDFYQRPSMSKVVQMLEGVCEVL QPPVSSQIGYRLYANAFKSSSEEGTSSGMSDYNSDALLSAVRLSGPR</aaseq>|
| |
| − | DNA = <dnaseqindica>1648..4185#tcctcctgtctctgcctctgctcggctagtctagtgtactactctatcttctcctcctctctttctcctacccaaatccatccacccaacatcttttttctcagccgtcgtctcatctcgccttcgtagcgttgcgtcgcgccgcgtctaccctttccaggtgagcctccccgattacatcgctcgttctagctagctagctagctagctcctgtgttcttgctgtttctttgtttctttttgcgtttttaattttcctttcttggatctttctttgctagctcgttttgatttgtgtgcttctgtatttgtgtgttttgtgggcgaaaggggggctttcttggttcttgttccgggcgattgttattcttgttctggagaatcggattacgagtgtgccttgcagtggagttttgtaatgttaggctccaattgagcaagaaaaagatgaggttcttgttaaattctaggttatccagctcttgtttggttggctggtctggaactctgaattccctctgtagctttttactaggtaatggaatcccctttgtaatgcaaaatgtagatgcctctgccatggctatgttttatctttagatgtccggaattctcttctaagggagcctaaacacggcagttcagttcagattaattatgggtctgggtttgaagaaaagaataaagggagtgaaataaagaaacaaacaggtctgaatttgtgaccctgtttagctgaaagtgaaactgaaaaggggaacagaaaggaagaattgaccatcgatttaatgttaggtgttactgcatatgtgcaagcaaagattgttcttttggcagtggataatgctctgatggtctctggccatgatcaagtggttgtttttctctgcaggatgtggtttaccttttgctgttggtcaaaaggaacttgtgccaccactttctagtttgtttgttttgacacttggtgctggcaattcggttgctcacgggctgatcaattccttttgctgatttctttttgagagaaatccctttttctttttcttttttatatatatgcctttttatcttgcaactcattcatttctcatgtttctgaaggtaacctggataagacggtggaggagctatcaaatgtttatagaggagctcaagaaaccaatagaaagctctatcaggaactgttcccaattcaggtagtatactggtttccgtttaccaattgtttcttgctatcgatcgatatcattaatcatcatatcttgttcaagccttcttgaaggttcaaacatccttgtaaatctgaactgagacatcatcttagtcactgttgtttgtccagcagcccacctgcatgttcacatgtaatctgacaccactaatttgaacctactgttactgtcaggcattgaaaaaaccaggcatctctgaatatcctctatttgtagctatcatgaacaacctgtttgagacccctcataagattcttgcatgcttgccagtgcaatttagaatcaagttacttagcaaaattttctgaataaattttgtagtatgctcctcagctatatttattctgcctatggtctgatatttctctccaaacagagcttctaacaatcttcattctgtgcactgcagattatgcaaatgtgtggatggttactgaaggttgttcgttgggaaaacttaaattgtgtgcacatggaagctcatggcaatcgtcgcagcagtccaacataccttgttatgctgtggatgatttcggtagctagcctattgataacatgtcgtggcagtatccagaagcaagttctctttccagggttcactgccgcgcaaatggattacattgataacgatgggatatttctgctttctaatggctctgtctttggctttggttttgtcacgagcaatgtctcagacaacacgttctacattcttgcagtggttcacatggccactactaccacagtctggtctgccaatcctaactctcctgtcacccattcagatgacttttttttcgacaaggatggcaatgccttcctgcagtcaggaggaggctccaatgtatgggctgccaatatctccgggaaagggactgccacctctatgcaactactggactctggcaatcttgtagtgcttgggaaagatgcctcttctcctctctggcaaagtttcagccatccgacagacactcttctgtctggtcagaatttcatcgaagggatgacgctgatgagcaagtccaacacagtacagaacatgacctatacacttcagatcaaatctgggaacatgatgttatacgccggcttcgagacacctcaaccatactggtctgcacagcaggatagcaggataattgtcaacaagaacggtgacagcatctactctgcaaacctcagttcagcttcttggtccttctatgatcaatcagggtcccttctatcacaacttgtcatcgcgcaagaaaatgccaatgccacattgtctgctgtccttggtagtgatggattgatagctttctatatgctgcagggtggaaatggcaagagtaaattctcgatcacagttccggcagactcttgtgacatgccagcctactgcagtccttacaccatttgcagtagtgggacaggttgccaatgccctttggccctcggctcgtttgcaaactgcaatcctggtgttacatcagcatgcaaatcgaacgaggagtttccgctggttcaactggatagtggagttggatatgtaggcactaacttcttccctcctgcggctaagacgaaccttacgggttgtaagagtgcctgtacaggcaactgctcttgtgttgctgtgttctttgatcaatcttcaggcaattgtttccttttcaaccagatcggaagcttgcagcacaaaggtgggaatacaactcgtttcgcatcttttatcaaggtatcaagcagaggaaaaggtgggagtgatagtggcagtgggaagcacaataccattattattgtcattatgctcggaactttggctatcataggcgtccttatttatattggtttctggatctacaagaggaagaggcatcctccaccatcacaagacgacgctggttcatcggaagatgatggatttctgcaaacaatatccggagcaccagtgcggttcacttacagggagctccaggatgcgacaagcaacttctgtaacaagcttggtcagggagggtttggatctgtgtatcttggtacactcccagacggcagtcgtattgctgtgaagaagctggagggcataggccaaggaaagaaagagttccgctctgaggtaacgatcattggtagtatccaccacatccatcttgtcaaactccgaggcttttgtactgagggaccacacaggcttcttgcctacgagtacatggcgaatgggtcgctggataagtggattttccattctaaagaagatgatcacctgctcgactgggatacaaggtttaacattgcgcttggaacggcaaagggattggcatacctccatcaggactgcgattcgaagattgtacactgtgacattaagcctgagaatgttctacttgacgacaacttcatcgcaaaggtatctgattttggccttgccaagttgatgaccagggagcagagccatgttttcactacgctcagaggcacgcgcgggtaccttgcacctgagtggctcaccaactatgccatctcagagaagagtgatgtgtacagctacggcatggttttgcttgagataatcggtgggaggaagagctacgatccctcggagatctccgagaaggctcacttcccttcctttgcattcaagaagctggaggaaggcgatcttcaggacatcttcgacgccaagctgaagtacaatgacaaggatgggcgggtcgagaccgcgatcaaggtcgcgctctggtgcatccaggatgatttctaccagagaccatccatgtcaaaggttgtgcagatgctcgaaggcgtctgcgaggtgctccagccaccggtgtcgtcgcagatcgggtacaggctctacgcaaacgccttcaaatcgagcagcgaggaggggacttcatcagggatgtcggactacaacagtgatgctctgctttcagctgtgaggctttctggtcccagatgatgtgaagaatcccatgtacagtgccttgtctagttaggttgcaaagtgtgcaaattttgctgtagtttccagtgttttggtgatcatttgcttcacactattgtacatatcttcttggtcatttctggtggtagtttatacatatcttgctgattatttatggtggtagtttatcggtgccattctttttttgttgcccttttgcttatacataaggtctccaaaacctttgacaattaccttttgtagttatgtcttggtaaaaataataggaaatgcaatgatacaaaagcctttttcatc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064221.1 RefSeq:Os06g0494100]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Function
This gene is originally derived from the Chinese cultivar Di-Gu,which is found on the sixth chromosome. It is the major gene of pricula oryzae, and it has an significant effect on the leaf resistance of ZB15 rice species to blast fungus.
Pi-d2 encodes a receptor-like kinase protein with a predicted extracellular domain of a bulb-type mannose specific binding lectin (B-lectin) and an intracellular serine–threonine kinase domain.(Chen et al., 2006).
The Pi-d2 full cDNA encodes a predicted protein of 825 amino acids with an estimated molecular mass of about 90 kDa.The N-terminus of Pi-d2, amino acids 1–32, contains a hydrophobic region with a predicted transit peptide function.(Chen et al., 2006).
Expression
Pi-d2 is a single copy gene, encoding a length of 825 amino acid transmembrane receptor protein kinases (RLK), the kinase containing a hydrophobic amino terminal signal peptide, B-lectin domain, PAN field and TM domain, the carboxy terminus is a typical serine/threonine kinase domain (STK). Because researchers previously have not found RLK outside B-lectin-containing membrane structure in rice, Pi-d2 belong to the new type of resistance genes, which is due to a difference in the anti-sense single base mutation caused by the disease that the 441th amino acid protein isoleucine (I) mutant protein changes to be a susceptible methionine (M) (Chen et al., 2006).
Pi-d2 was constitutively expressed in the rice variety Digu and not induced after M. grisea strain ZB15 inoculation (Figure 5b,c). Northern analysis also showed that the Pi-d2 gene was constitutively expressed in leaves, roots and stems (Figure 5d).(Chen et al., 2006).
Because of its novel extracellular domain, Pi-d2 represents a new class of plant resistance genes(Chen et al., 2006)
Evolution
Pi-d2 is located on rice chromosome 6 near the centromere region, and connects with RM527 and RM3 chain, the genetic distances is 3.2cM and 3.4cM respectively.(Chen et al., 2004)
All the predicted amino acids from susceptible rice varieties share a common amino acid difference, I441M, relative to the resistant rice Digu. Therefore, the corresponding RLK gene in Digu was identified as a potential candidate of Pi-d2.(Chen et al., 2006)
Labs working on this gene
Rice Research institute of Sichuan Agricultural University
References
1. Yusuke Kouzai;Hanae Kaku;Naoto Shibuya;Eiichi Minami;Yoko Nishizawa;Yusuke Kouzai Expression of the chimeric receptor between the chitin elicitor receptor CEBiP and the receptor-like protein kinase Pi-d2 leads to enhanced responses to the chitin elicitor and disease resistance against Magnaporthe oryzae in rice. Plant Molecular Biology, 2013, 81(3): 287-295
2. CHEN De-xi;CHEN Xue-wei;LEI Cai-lin;MA Bing-tian;WANG Yu-ping;LI Shi-gui Rice Blast Resistance of Transgenic Rice Plants with Pi-d2 Gene Rice Science, 2010, 17(3): 179-184
3. CHEN De-xi;CHEN Xue-wei;MA Bing-tian;WANG Yu-ping;ZHU Li-huang;LI Shi-gui Genetic Transformation of Rice with Pi-d2 Gene Enhances Resistance to Rice Blast Fungus Magnaporthe oryzae Rice Science, 2010, 17(1): 19-27
4. Xuewei Chen;Junjun Shang;Dexi Chen;Cailin Lei;Yan Zou;Wenxue Zhai;Guozhen Liu;Jichen Xu;Zhongzhuan Ling;Gang Cao;Bingtian Ma;Yuping Wang;Xianfeng Zhao;Shigui Li;Lihuang Zhu A B-lectin receptor kinase gene conferring rice blast resistance The Plant Journal, 2006, 46(5): 794-804
5. X. W. Chen; S. G. Li; J. C. Xu; W. X. Zhai; Z. Z. Ling; B. T. Ma; Y. P. Wang; W. M. Wang; G. Cao; Y. Q. Ma; J. J. Shang; X. F. Zhao; K. D. Zhou and L. H. Zhu Identification of Two Blast Resistance Genes in a Rice Variety, Digu Journal of Phytopathology, 2004, 152(2): 77-85 Phytopathology, 2004, 152(2): 77-85
Structured Information