Difference between revisions of "Os06g0651100"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The gene ''YK1''(HC-toxin reductase like rice gene)is associated with '''metabolic alteration''' of rice<ref name="ref1"/><ref name="ref2"/><ref name="ref3"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*Alteration of metabolites as well as proteins may contribute to '''multiple stress tolerances''' in transgenic ''YK1'' rice. Ectopic over-expression of a single gene (''YK1'') in rice cells might affect the expression of unrelated proteins and metabolites<ref name="ref1"/>.
 +
 
 +
*The overexpression of ''YK1'' in calli enhanced synthesis and the reduction state of GSH concomitantly with NAD(P)(H) production. Since the ratio of GSH to GSSG increased, YK1 calli might enhance tolerance to '''oxidative stresses'''. On the other hand, the amounts of GSH in YK1 plants were only marginally increased and the activities of GPX and GR were not altered<ref name="ref2"/>.
 +
 
 +
*The YK1-overexpressing rice plants showed enhanced resistance to rice '''blast disease''' and to abiotic stresses like '''UV''' radiation, increased '''salinity''', and '''submergence'''<ref name="ref4"/>. ''YK1'' possesses the catalytic activity to convert taxifolin to leucocyanidin<ref name="ref3"/>.
 +
 
 +
*The overexpression of ''YK1'' (DFR) was associated with slight changes in the amounts of several metabolites analysed in whole plants, whilst glutathione derivatives were substantially increased in suspensioncultured cells<ref name="ref2"/>. Transgenic rice plants harboring the ''YK1'' gene showed high resistance against blast infection<ref name="ref4"/>. The combination of dihydroflavonol-4-reductase activity and the elevated level of NAD(P)H pool may confer the prevention of induced cell death in planta<ref name="ref3"/>.
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824], [http://amigo.geneontology.org/amigo/term/GO:0009225 GO:0009225], [http://amigo.geneontology.org/amigo/term/GO:0051287 GO:0051287]
 +
 
 +
===Mutation===
 +
YK1-transformed plants<ref name="ref2"/><ref name="ref3"/><ref name="ref4"/>:
 +
 
 +
L-1 
 +
 
 +
L-2
 +
 
 +
*The amount of GSH was increased in YK1 lines by 291% for L-1 and 204% for L-2 over the control. Likewise, the amount of GSSG was increased by 131% (L-1) and 134% (L-2), respectively<ref name="ref2"/>.
 +
 
 +
*The total amounts of NAD(H) and NADP(H) in 5-day-old YK1 calli (L-1 and L-2) were higher than the control. In the case of NAD synthetase and NAD kinase, both L-1 and L-2 callus lines showed higher activities than the control<ref name="ref3"/>.
 +
 
 +
*ADH, GAPDH, and ME activity were enhanced in YK1-overexpressing cultured cells (L-1). L-1 and L-2 transgenic cells showed apparent H<sub>2</sub>O<sub>2</sub> stress tolerance (Fig. 4A). Moreover, an ion leakage assay using excised leaves also demonstrated that both L-1 and L-2 lines leaked fewer ions than the control<ref name="ref3"/>.
 +
 
 +
*Both L-1 and L-2 lines exhibited relatively reduced disease severity compared with the control plants where actively spreading lesions were developed on leaves of the control plants, whereas unexpanded lesions were formed on the YK1 lines<ref name="ref3"/>.
 +
 
 +
*Although transgenic cells over-expressing YK1 (L-1 and L-2) showed similar production of H<sub>2</sub>O<sub>2</sub>, the level was significantly lower than the control cells after equilibration for at least 3h<ref name="ref4"/>.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*Ectopic overexpression of YK1 protein can be used for the molecular breeding of biotic- and abiotic-resistant rice breeding. YK1 is not involved in the anti-oxidant activities, but may inhibit some ROS generating enzymes<ref name="ref4"/>.
 +
 
 +
*The overexpression of ''YK1'' in both suspension-cultured cells and rice plants increased NAD(H) and NADP(H) levels by causing an increase in NAD synthetase and NAD kinase activities<ref name="ref3"/>.
 +
 
 +
*The overexpression of ''YK1'' in rice altered the activities of enzymes engaged in NAD biosynthesis, and of enzymes requiring NAD(P) as coenzymes. Moreover, overexpression of YK1 in rice conferred the prevention of cell death caused by the hydrogen peroxide as well as the bacterial disease<ref name="ref3"/>.
 +
 
 +
*In YK1 (DFR)-overexpressing plants, the concentrations of cis-aconitate, isocitrate and 2-oxoglutarate were higher in leaves, whereas those of fructose-1,6-bisphosphate and glyceraldehyde-3-phosphate were lower in roots. In seeds, the amounts of free amino acids and metals were altered, whereas sugars in seeds were kept constant. In ''YK1'' calli, an approx. 3-fold increase in glutathione was observed, whereas the activities of glutathione peroxidase and glutathione reductase were concomitantly increased<ref name="ref2"/>.
 +
 
 +
*The ''YK1'' gene expression has less or no effects for tolerance to infection with the bacterial blight. Overexpression of ''YK1'' conferred resistance phenotype to the bacterial brown stripe<ref name="ref3"/>.
 +
[[File: YK1 metabolic.jpg|right|thumb|200px|'''Figure 1.''' ''Diagram illustrating the biochemical functions of YK1 protein in
 +
relation to flavonoid and NAD homeostasis in the metabolic pathways.(from reference <ref name="ref2"/>).'']]
 +
*The overexpression of a single gene can cause metabolic alterations by changing the activities of other enzymes related to NAD homeostasis. It may be presumed that overexpressed YK1 protein may use more NAD(P)H than normal level, which in turn pumps up nicotinamide coenzymes by activating responsible enzymes. Such concomitant relation leading to cell-death tolerance is presented in Fig. 1. In addition, high-throughput analysis of metabolites by Fourier transform ion cyclotron resonance MS in transgenic YK1 plants suggested alteration in other metabolite levels (27)<ref name="ref3"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
The deduced 363 amino acid sequences shared 78 percent homology with maize HC-toxin reductase (Figure 1). The α β α-dinucleotide binding consensus sequence in YK1 gene is also identical at the N-terminal side to its homologues. Such homology can be seen with dehydroflavonol-4-reductase (DHFR), and NADPH dependent carbonyl reductase<ref name="ref4"/>.
 +
 
 +
===Knowledge Extension===
 +
Metabolome analysis in plants has been performed using different types of mass spectrometers. Non-target metabolome analysis of strawberry using a Fourier transform ion cyclotron mass spectrometer (FT-MS) allowed the detection of thousands of metabolites<ref name="ref5"/>. ''Mungur et al.''<ref name="ref6"/> showed alterations of metabolites such as amino acids, sugars, lipids, nucleic acids and other organic acids in transgenic tobacco plants exhibiting higher glutamate dehydrogenase activity. Furthermore, fingerprints obtained from FT-MS analysis provided a tremendous amount of information by matching gene expression profiles<ref name="ref7"/>.  
  
You can also add sub-section(s) at will.
+
Additionally, CE/MS revealed that the amount of metabolites engaged in the tricarboxylic acid (TCA) cycle was altered in transgenic rice expressing the antisense methylmalonate-semialdehyde dehydrogenase gene<ref name="ref8"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Institute of Molecular and Cellular Biosciences,The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-0032, Japan
 +
*Department of Molecular Genetics, National Institute of Agrobiological Resources, 2-1-9 Kannondai, Tsukuba, Ibaraki 305-8601,Japan
 +
*Plant Molecular Biology Group, Laboratory of Environmental Science, Central Research Institute Electric Power Industry, 1646 Abiko, Chiba 270-1194, Japan
 +
*Institute for Advanced Biosciences, University of Keio, Tsuruoka, Yamagata 997-0017, Japan
 +
*Iwate Biotechnology Research Center, Kitakami, Iwate 024-0003, Japan
 +
*Shiraoka Research Station of Biological Science, Nissan Chemical Industries, LTD., 1470, Shiraoka, Minamisaitama, Saitama, 349-0294, Japan
 +
*Department of Applied Biological Science, Science University of Tokyo, Noda, Chiba, 278-8510, Japan;
 +
*Biological Science, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Takahashi H, Hotta Y, Hayashi M, et al. High throughput metabolome and proteome analysis of transgenic rice plants (Oryza sativa L.)[J]. Plant biotechnology, 2005, 22(1): 47-50.
 +
</ref>
 +
* <ref name="ref2">
 +
Takahashi H, Hayashi M, Goto F, et al. Evaluation of metabolic alteration in transgenic rice overexpressing dihydroflavonol-4-reductase[J]. Annals of botany, 2006, 98(4): 819-825.
 +
</ref>
 +
* <ref name="ref3">
 +
Hayashi M, Takahashi H, Tamura K, et al. Enhanced dihydroflavonol-4-reductase activity and NAD homeostasis leading to cell death tolerance in transgenic rice[J]. Proceedings of the National Academy of Sciences of the United States of America, 2005, 102(19): 7020-7025.
 +
</ref>
 +
* <ref name="ref4">
 +
Uchimiya H, Fujii S, Huang J, et al. Transgenic rice plants conferring increased tolerance to rice blast and multiple environmental stresses[J]. Molecular Breeding, 2002, 9(1): 25-31.
 +
</ref>
 +
* <ref name="ref5">
 +
Aharoni A, Ric de Vos C H, Verhoeven H A, et al. Nontargeted metabolome analysis by use of Fourier transform ion cyclotron mass spectrometry[J]. Omics: a journal of integrative biology, 2002, 6(3): 217-234.
 +
</ref>
 +
* <ref name="ref6">
 +
Mungur R, Glass A D M, Goodenow D B, et al. Metabolite fingerprinting in transgenic Nicotiana tabacum altered by the Escherichia coli glutamate dehydrogenase gene[J]. BioMed Research International, 2005, 2005(2): 198-214.
 +
</ref>
 +
* <ref name="ref7">
 +
Hirai M Y, Yano M, Goodenowe D B, et al. Integration of transcriptomics and metabolomics for understanding of global responses to nutritional stresses in Arabidopsis thaliana[J]. Proceedings of the National academy of Sciences of the United States of America, 2004, 101(27): 10205-10210.
 +
</ref>
 +
* <ref name="ref8">
 +
Tanaka N, Takahashi H, Kitano H, et al. Proteome approach to characterize the methylmalonate-semialdehyde dehydrogenase that is regulated by gibberellin[J]. Journal of proteome research, 2005, 4(5): 1575-1582.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0651100|
 
Description = Similar to NADPH HC toxin reductase|
 
Version = NM_001064761.1 GI:115469253 GeneID:4341690|
 
Length = 6308 bp|
 
Definition = Oryza sativa Japonica Group Os06g0651100, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:27529927..27536234|
 
CDS = 27530108..27530264,27533416..27533804,27534247..27534459,27535722..27535900,27535984..27536122<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008399:27529927..27536234
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:27529927..27536234
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggaggagtcagggaggaggagcggcggcggcgtcagggtgtgcgtcaccggcggcgctgggttcatcggctcgtggctcgtcaagaagctcctcggcgccggctacaccgtgcacgccaccctgcgaagcataggggacgaggtgaaggtgggcctcctgcggcggctcgtccccggcgacgcgccgccggagcggctgcgcctgttcgaggccgacctctacgacgccgccaccttcgctccggccatcgccggctgccagttcgtcttcctcgtcgccacgcccttcctccatgacgccaccagcacgaagtacaataacacggcggaggcggcgctggacgcggcacgggtgatcctccggcaatgcgaggaatccagcacggtgaagcgcgtcatctacacgagctccatggctgcgacctcgccgctcaaggaggactccaccggcttcaaggactccatcgacgaatcctgctggacgccgctcgccgtcgactacccttaccggagcgcacggttcgatgagtacatcctgtcgaagctgctgtcggagaaggagctgctggggcacagccacgctggcgagaggcggaggccggcggtcgaggtggtgacggtgccgtgctccgtcgtcgccggcgggacgctgcaggggcagtcgacgacgagcctggactgcgtcgtgtcgccggtgtcccgggacgagggccgcttccgggcgctcaggctgctgcagaggctgatggggtcggtgccgatggtgcacgtcgacgacgtctgcgacgcgctcgtcttctgcatggagcagccgtccctcaccggccggttcctctgctccgccgcgtacccgactctcgacgacatcgtcgaacacttcgccggcaagtaccctcacctcgacctcctcaaagaaacggagacattgccgagcattcaagctcacactgataagctgggggagctggggttcaagtacaagtacggaatggaggagatactggacgagagcgtggaatgcgcggtgagacttggttgccttgatgcgtccaagcttagtttacaaggatga</cdnaseq>|
 
AA = <aaseq>MAEESGRRSGGGVRVCVTGGAGFIGSWLVKKLLGAGYTVHATLR                    SIGDEVKVGLLRRLVPGDAPPERLRLFEADLYDAATFAPAIAGCQFVFLVATPFLHDA                    TSTKYNNTAEAALDAARVILRQCEESSTVKRVIYTSSMAATSPLKEDSTGFKDSIDES                    CWTPLAVDYPYRSARFDEYILSKLLSEKELLGHSHAGERRRPAVEVVTVPCSVVAGGT                    LQGQSTTSLDCVVSPVSRDEGRFRALRLLQRLMGSVPMVHVDDVCDALVFCMEQPSLT                    GRFLCSAAYPTLDDIVEHFAGKYPHLDLLKETETLPSIQAHTDKLGELGFKYKYGMEE                    ILDESVECAVRLGCLDASKLSLQG</aaseq>|
 
DNA = <dnaseqindica>5971..6127#2431..2819#1776..1988#335..513#113..251#ttgtcccaagtctgaatcaaaatatcagatacagccaatcagccatgcgtaccaatctgcacacagtgagcggcggctacccgatctggtactggtagtagcaggaacgacgatggcggaggagtcagggaggaggagcggcggcggcgtcagggtgtgcgtcaccggcggcgctgggttcatcggctcgtggctcgtcaagaagctcctcggcgccggctacaccgtgcacgccaccctgcgaagcataggtacacgcggttcaacgctccggcgcggcgatcgatccccctaccgcgcgtcgcgtcgctgatttggtcgcgtggtttttcaggggacgaggtgaaggtgggcctcctgcggcggctcgtccccggcgacgcgccgccggagcggctgcgcctgttcgaggccgacctctacgacgccgccaccttcgctccggccatcgccggctgccagttcgtcttcctcgtcgccacgcccttcctccatgacgccaccagcacgaaggtaaaaaaaaaaaaaaacagagaaaactctcatctcactctagtacaccctccgtcccaaattaaaagatatatattttttacacttttaataatatattttaatcattaatttatctcgtgttatattttcaataaatataaaattagcatcgtattaaagtactaaatctagtgatataatatacttaatacttacatacgtatggttagtataattattaataaaaaagttatcatgtttgattttttaaaaaaaacaggacggtcctgtaatttgttacggagagagtactatttaatcgttcttttcaatgaggcaattaattagtagtcctacacagtcacatggtttgctttgattgatggcgtcgtatgtcaccgggattatattcctctccacatggttgaattgggggagctcgcatagcatgtcaggatgtgaatggttaggatatggattgaacataaactgttttgagtgagtttgttgatctatggtttaatagggtcaatctatcatgagtccattatattaatagattatccatggatatccaaatggatcggttacattactagtagaaaaaaaaactcttattacatatatgcaaaactcggatcgaaaatttttgaactcgtattcacactataacaacttatcgaattcagtcgaattttggtgggataatttattgcacagagaagcaaatttgtgtaaattttgagccctttatatatatagggcccacaacgcactactaatatactaagaaaatttcattatgtgtgtaaactcggacccaaaattttaaactcacgttcacattataaaaacttattaaatttagttgaattttttagaaatgatttattatatagagaagcaactttattcaaattttaagccatttagacatgcgaggcccacaatgcattactaagacccaaaaattttagttacgtgtgtaaaactcggacctaaaatttttaaactcgtgttcacactttaaaaacttgtcaaatttagttgaatttaataggaatgaattattatagagagaagcaattttatataaatttttgaaacatttatagatgtgaagtcattttgggttgaaccccttaaacctaggttctagtggtttcatccgttttatccatttatatttttggttcgaccctaaaaatccattagaataaatttacggacaggttttaaatggatcgaccctaaccattcccatcctgaatcgcatgcagtacaataacacggcggaggcggcgctggacgcggcacgggtgatcctccggcaatgcgaggaatccagcacggtgaagcgcgtcatctacacgagctccatggctgcgacctcgccgctcaaggaggactccaccggcttcaaggactccatcgacgaatcctgctggacgccgctcgccgtcgactacccttaccggagcgcacggttcgatgtaaaaaaaaaagaaaaatcacgacgaacttcggagatgaattctaatcactcgagtgaatatccactcatatagtgcatatcaactaaataatcttgaaaaaaattcaaaaacatttacaagatagattgatatataacttcacaaacatacatgttaaaattcaatttttataagtcgtaataaaaaataacaaatttaactgtgaatatacgtatactattcagagtttgatttgttatttttgttataacttgtagaagccgaatttaaacttgtatgtttgtggggtgatatattacatataaatctatcttgttaaattttttgaatttttttcatgcacatttagttgacagtgcaacaaatagttggatgtctacctagctgtgattaaaagtgtttcccgacgaaccgacgatctcaaaatctatctatgcaggagtacatcctgtcgaagctgctgtcggagaaggagctgctggggcacagccacgctggcgagaggcggaggccggcggtcgaggtggtgacggtgccgtgctccgtcgtcgccggcgggacgctgcaggggcagtcgacgacgagcctggactgcgtcgtgtcgccggtgtcccgggacgagggccgcttccgggcgctcaggctgctgcagaggctgatggggtcggtgccgatggtgcacgtcgacgacgtctgcgacgcgctcgtcttctgcatggagcagccgtccctcaccggccggttcctctgctccgccgcgtacccgactctcgacgacatcgtcgaacacttcgccggcaagtaccctcacctcgacctcctcaaagagtaagtctccactaattctacaaacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttatgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttacattatatccagaatactctctctccctaaatatttggcaccgttaattatttttaaacatgtttaactgtttatcttattcaaaaacttttgtgaaatttgtaaaactatatgtatacataaaagtatatttaacaatgaaccaaatgatagaaaacaaattaataattacttaaattttttgaataagatgaacggtcaaacatgtttaaaaaaatcaatggtatcaaatatttagggacggagggagtatttcacgtgatgattggattgtttgcgttgaactattctctttatctcacataaaaccaatatatgtctcacagaaaaccaacatacgataagatgtaatattatctagtgcaacgaatttagattaatgtatatctagatggagtactatatagtgtcatatcctattttagatttgtttttgttggaacggatagggatatcaatcatctgaaaataatacattagagatgggattgattaaatgttggaacttaattggtgtcagaacggagacattgccgagcattcaagctcacactgataagctgggggagctggggttcaagtacaagtacggaatggaggagatactggacgagagcgtggaatgcgcggtgagacttggttgccttgatgcgtccaagcttagtttacaaggatgataatatcatcctgattagtgcaatttaccatcattattgtgttggtgtgcctcttcaggcgttctaattactatacttaaaataaaaaggagcaatggagcattccttggcgtcattggtttacagtcgtgtactcgtgtactaccagcaatctgaaatctgaacttcatttttcactgtc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064761.1 RefSeq:Os06g0651100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:21, 12 June 2015

The gene YK1(HC-toxin reductase like rice gene)is associated with metabolic alteration of rice[1][2][3].

Annotated Information

Function

  • Alteration of metabolites as well as proteins may contribute to multiple stress tolerances in transgenic YK1 rice. Ectopic over-expression of a single gene (YK1) in rice cells might affect the expression of unrelated proteins and metabolites[1].
  • The overexpression of YK1 in calli enhanced synthesis and the reduction state of GSH concomitantly with NAD(P)(H) production. Since the ratio of GSH to GSSG increased, YK1 calli might enhance tolerance to oxidative stresses. On the other hand, the amounts of GSH in YK1 plants were only marginally increased and the activities of GPX and GR were not altered[2].
  • The YK1-overexpressing rice plants showed enhanced resistance to rice blast disease and to abiotic stresses like UV radiation, increased salinity, and submergence[4]. YK1 possesses the catalytic activity to convert taxifolin to leucocyanidin[3].
  • The overexpression of YK1 (DFR) was associated with slight changes in the amounts of several metabolites analysed in whole plants, whilst glutathione derivatives were substantially increased in suspensioncultured cells[2]. Transgenic rice plants harboring the YK1 gene showed high resistance against blast infection[4]. The combination of dihydroflavonol-4-reductase activity and the elevated level of NAD(P)H pool may confer the prevention of induced cell death in planta[3].

GO assignment(s): GO:0003824, GO:0009225, GO:0051287

Mutation

YK1-transformed plants[2][3][4]:

L-1

L-2

  • The amount of GSH was increased in YK1 lines by 291% for L-1 and 204% for L-2 over the control. Likewise, the amount of GSSG was increased by 131% (L-1) and 134% (L-2), respectively[2].
  • The total amounts of NAD(H) and NADP(H) in 5-day-old YK1 calli (L-1 and L-2) were higher than the control. In the case of NAD synthetase and NAD kinase, both L-1 and L-2 callus lines showed higher activities than the control[3].
  • ADH, GAPDH, and ME activity were enhanced in YK1-overexpressing cultured cells (L-1). L-1 and L-2 transgenic cells showed apparent H2O2 stress tolerance (Fig. 4A). Moreover, an ion leakage assay using excised leaves also demonstrated that both L-1 and L-2 lines leaked fewer ions than the control[3].
  • Both L-1 and L-2 lines exhibited relatively reduced disease severity compared with the control plants where actively spreading lesions were developed on leaves of the control plants, whereas unexpanded lesions were formed on the YK1 lines[3].
  • Although transgenic cells over-expressing YK1 (L-1 and L-2) showed similar production of H2O2, the level was significantly lower than the control cells after equilibration for at least 3h[4].

Expression

  • Ectopic overexpression of YK1 protein can be used for the molecular breeding of biotic- and abiotic-resistant rice breeding. YK1 is not involved in the anti-oxidant activities, but may inhibit some ROS generating enzymes[4].
  • The overexpression of YK1 in both suspension-cultured cells and rice plants increased NAD(H) and NADP(H) levels by causing an increase in NAD synthetase and NAD kinase activities[3].
  • The overexpression of YK1 in rice altered the activities of enzymes engaged in NAD biosynthesis, and of enzymes requiring NAD(P) as coenzymes. Moreover, overexpression of YK1 in rice conferred the prevention of cell death caused by the hydrogen peroxide as well as the bacterial disease[3].
  • In YK1 (DFR)-overexpressing plants, the concentrations of cis-aconitate, isocitrate and 2-oxoglutarate were higher in leaves, whereas those of fructose-1,6-bisphosphate and glyceraldehyde-3-phosphate were lower in roots. In seeds, the amounts of free amino acids and metals were altered, whereas sugars in seeds were kept constant. In YK1 calli, an approx. 3-fold increase in glutathione was observed, whereas the activities of glutathione peroxidase and glutathione reductase were concomitantly increased[2].
  • The YK1 gene expression has less or no effects for tolerance to infection with the bacterial blight. Overexpression of YK1 conferred resistance phenotype to the bacterial brown stripe[3].
Figure 1. Diagram illustrating the biochemical functions of YK1 protein in relation to flavonoid and NAD homeostasis in the metabolic pathways.(from reference [2]).
  • The overexpression of a single gene can cause metabolic alterations by changing the activities of other enzymes related to NAD homeostasis. It may be presumed that overexpressed YK1 protein may use more NAD(P)H than normal level, which in turn pumps up nicotinamide coenzymes by activating responsible enzymes. Such concomitant relation leading to cell-death tolerance is presented in Fig. 1. In addition, high-throughput analysis of metabolites by Fourier transform ion cyclotron resonance MS in transgenic YK1 plants suggested alteration in other metabolite levels (27)[3].

Evolution

The deduced 363 amino acid sequences shared 78 percent homology with maize HC-toxin reductase (Figure 1). The α β α-dinucleotide binding consensus sequence in YK1 gene is also identical at the N-terminal side to its homologues. Such homology can be seen with dehydroflavonol-4-reductase (DHFR), and NADPH dependent carbonyl reductase[4].

Knowledge Extension

Metabolome analysis in plants has been performed using different types of mass spectrometers. Non-target metabolome analysis of strawberry using a Fourier transform ion cyclotron mass spectrometer (FT-MS) allowed the detection of thousands of metabolites[5]. Mungur et al.[6] showed alterations of metabolites such as amino acids, sugars, lipids, nucleic acids and other organic acids in transgenic tobacco plants exhibiting higher glutamate dehydrogenase activity. Furthermore, fingerprints obtained from FT-MS analysis provided a tremendous amount of information by matching gene expression profiles[7].

Additionally, CE/MS revealed that the amount of metabolites engaged in the tricarboxylic acid (TCA) cycle was altered in transgenic rice expressing the antisense methylmalonate-semialdehyde dehydrogenase gene[8].

Labs working on this gene

  • Institute of Molecular and Cellular Biosciences,The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-0032, Japan
  • Department of Molecular Genetics, National Institute of Agrobiological Resources, 2-1-9 Kannondai, Tsukuba, Ibaraki 305-8601,Japan
  • Plant Molecular Biology Group, Laboratory of Environmental Science, Central Research Institute Electric Power Industry, 1646 Abiko, Chiba 270-1194, Japan
  • Institute for Advanced Biosciences, University of Keio, Tsuruoka, Yamagata 997-0017, Japan
  • Iwate Biotechnology Research Center, Kitakami, Iwate 024-0003, Japan
  • Shiraoka Research Station of Biological Science, Nissan Chemical Industries, LTD., 1470, Shiraoka, Minamisaitama, Saitama, 349-0294, Japan
  • Department of Applied Biological Science, Science University of Tokyo, Noda, Chiba, 278-8510, Japan;
  • Biological Science, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601, Japan

References

  1. 1.0 1.1 Takahashi H, Hotta Y, Hayashi M, et al. High throughput metabolome and proteome analysis of transgenic rice plants (Oryza sativa L.)[J]. Plant biotechnology, 2005, 22(1): 47-50.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 Takahashi H, Hayashi M, Goto F, et al. Evaluation of metabolic alteration in transgenic rice overexpressing dihydroflavonol-4-reductase[J]. Annals of botany, 2006, 98(4): 819-825.
  3. 3.00 3.01 3.02 3.03 3.04 3.05 3.06 3.07 3.08 3.09 3.10 Hayashi M, Takahashi H, Tamura K, et al. Enhanced dihydroflavonol-4-reductase activity and NAD homeostasis leading to cell death tolerance in transgenic rice[J]. Proceedings of the National Academy of Sciences of the United States of America, 2005, 102(19): 7020-7025.
  4. 4.0 4.1 4.2 4.3 4.4 4.5 Uchimiya H, Fujii S, Huang J, et al. Transgenic rice plants conferring increased tolerance to rice blast and multiple environmental stresses[J]. Molecular Breeding, 2002, 9(1): 25-31.
  5. Aharoni A, Ric de Vos C H, Verhoeven H A, et al. Nontargeted metabolome analysis by use of Fourier transform ion cyclotron mass spectrometry[J]. Omics: a journal of integrative biology, 2002, 6(3): 217-234.
  6. Mungur R, Glass A D M, Goodenow D B, et al. Metabolite fingerprinting in transgenic Nicotiana tabacum altered by the Escherichia coli glutamate dehydrogenase gene[J]. BioMed Research International, 2005, 2005(2): 198-214.
  7. Hirai M Y, Yano M, Goodenowe D B, et al. Integration of transcriptomics and metabolomics for understanding of global responses to nutritional stresses in Arabidopsis thaliana[J]. Proceedings of the National academy of Sciences of the United States of America, 2004, 101(27): 10205-10210.
  8. Tanaka N, Takahashi H, Kitano H, et al. Proteome approach to characterize the methylmalonate-semialdehyde dehydrogenase that is regulated by gibberellin[J]. Journal of proteome research, 2005, 4(5): 1575-1582.

Structured Information