|
|
| (9 intermediate revisions by one other user not shown) |
| Line 1: |
Line 1: |
| − | Please input one-sentence summary here.
| + | Os06g0695800 is the gene STAR1 which is responsible for Al tolerance in rice. |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Aluminum (Al) toxicity is a major factor limiting crop production in acidic soil, but the molecular mechanisms of Al tolerance are poorly understood. The gene STAR1(for sensitive to Al rhizotoxicity1) is responsible for Al tolerance in rice. Proteins encoded by STAR1 form a complex that functions as a unique ATP binding cassette (ABC) transporter, which is required for detoxification of Al in rice. The results described that STAR1 is translated to NBD, respectively, and then functions as an ABC transporter protein complex. However, the function of most ABC transporters is still unknown. | + | [[File:Y_1.jpg|right|thumb|150px|Map-Based Cloning and Complementation of STAR1.]] |
| | + | [[File:Y_3.jpg|right|thumb|150px|STAR1 sequence, conserved motifs and star1 mutation.]] |
| | + | Aluminum (Al) toxicity is a major factor limiting crop production in acidic soil, but the molecular mechanisms of Al tolerance are poorly understood. The gene STAR1(for sensitive to Al rhizotoxicity1) is responsible for Al tolerance in rice. Proteins encoded by STAR1 form a complex that functions as a unique ATP binding cassette (ABC) transporter, which is required for detoxification of Al in rice. The results described that STAR1 is translated to NBD, respectively, and then functions as an ABC transporter protein complex.<ref name="ref1" /> However, the function of most ABC transporters is still unknown. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | STAR1 is mainly expressed in the roots, and mRNA accumulation of STAR1 is significantly enhanced when seedlings were exposed to aluminum. A time-course experiment showed that the expression of STAR1 was similarly induced by aluminum as early as 2h after the exposure. Furthermore, an aluminum concentration as low as 5μM triggered the expression of STAR1, and the expression level increased with increasing external aluminum concentration. The mRNA accumulation of STAR1 does not respond to low pH and other metals, indicating that STAR1 is specifically induced by aluminum. | + | [[File:Y_2.jpg|left|thumb|150px|Expression Analysis of STAR1and STAR2.]] |
| | + | [[File:Y_4.jpg|left|thumb|150px|Expression of STAR1 in different root segments.]] |
| | + | STAR1 is mainly expressed in the roots, and mRNA accumulation of STAR1 is significantly enhanced when seedlings were exposed to aluminum. A time-course experiment showed that the expression of STAR1 was similarly induced by aluminum as early as 2h after the exposure. Furthermore, an aluminum concentration as low as 5μM triggered the expression of STAR1, and the expression level increased with increasing external aluminum concentration<ref name="ref1" />. The mRNA accumulation of STAR1 does not respond to low pH and other metals, indicating that STAR1 is specifically induced by aluminum. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | There is no homolog of STAR1 in the rice genome. STAR1 also showed similarity to the NBD subunit of the bacterial phosphate transporter, pstB, and the similarity to this transporter is higher than any other plant ABC transporters . | + | There is no homolog of STAR1 in the rice genome. STAR1 also showed similarity to the NBD subunit of the bacterial phosphate transporter, pstB, and the similarity to this transporter is higher than any other plant ABC transporters<ref name="ref1" />. |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | ·Research Institute for Bioresources, Okayama University, Kurashiki 710-0046, Japan. |
| | + | ·QTL Genomics Research Center, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan. |
| | + | ·Genome Resource Center, Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan. |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | <references> |
| | + | <ref name="ref1">Chao Feng Huang, Naoki Yamaji, Namiki Mitani, et.al. (2009) A Bacterial-Type ABC Transporter Is Involved in Aluminum Tolerance in Rice. The Plant Cell, Vol. 21: 655-667.</ref> |
| | + | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0695800|
| |
| − | Description = ABC transporter related domain containing protein|
| |
| − | Version = NM_001064988.1 GI:115469707 GeneID:4341938|
| |
| − | Length = 3671 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0695800, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:29949363..29953033|
| |
| − | CDS = 29949652..29949902,29950000..29950188,29952135..29952479,29952576..29952831|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:29949363..29953033
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:29949363..29953033
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgcgtcgtctgggactttcccttcaccacgacacgagtccaagcttcgctgcccttgcttgcaaccagcggccgccaccgaatggcaccgttcacgcgtgctccaaaagccgcccacctcagttggagccgggaaaagttggcaaaaagccaataaaaaagacgatgcgcattgcccggattcccacttcgatcccccctcaccttcgtcttcctctcgacctctccgctgtctctccgatgggctcagcttcagagcatgatgtcagggagcacctgctggacgtggacggcgtcggggaagaaggggcggcggcggcggcggggccgaagatacgggtgcgggggctgacgcggcggtcggaggcgagaggcgaggagatcctgcggggcgtcgacctggacgtgccgcgcggggtggtcgtcggcgtcatcggccccagcggcagcggcaagtccacgctgctccgcgcgctcaaccgcctctgggagcccgcgccgggcgccgtgctcctcgacggcgtcgacatctgcggcatcgacgtcctcgcgctccgccggaaggtcggcatgctcttccagctccccgccatgttcgacggaaccgtggctgacaacgtgcgatacgggccacagctgcagggcaagaagctgacggacgccgaggtgcagagcctactgagcctcgccgacctggaccctgctctctgctccaagcccgcctccgagctctccgtcggccaggcgcagcgcgtcgcattggctcgcaccctcgccaacgatccggaggtgcttctgctggatgagccgacgagcgcgttggatcccatctcgacgcagaacatcgaggaggcgatcgtgcggctgaagaagacgagggggctcaccacggtgatggtgtcgcacagcgtgaagcagatccagcggatcgccgacctggtctgcctcctcgtcgccggcgaggtcgtcgaggtgctcccgccgtcggagctgtccgaggccaagcaccccatggcacggcgcttcctcgagctcagctga</cdnaseq>|
| |
| − | AA = <aaseq>MRRLGLSLHHDTSPSFAALACNQRPPPNGTVHACSKSRPPQLEP GKVGKKPIKKTMRIARIPTSIPPHLRLPLDLSAVSPMGSASEHDVREHLLDVDGVGEE GAAAAAGPKIRVRGLTRRSEARGEEILRGVDLDVPRGVVVGVIGPSGSGKSTLLRALN RLWEPAPGAVLLDGVDICGIDVLALRRKVGMLFQLPAMFDGTVADNVRYGPQLQGKKL TDAEVQSLLSLADLDPALCSKPASELSVGQAQRVALARTLANDPEVLLLDEPTSALDP ISTQNIEEAIVRLKKTRGLTTVMVSHSVKQIQRIADLVCLLVAGEVVEVLPPSELSEA KHPMARRFLELS</aaseq>|
| |
| − | DNA = <dnaseqindica>3132..3382#2846..3034#555..899#203..458#accaagttgccgatgtgcttatctggtcctggtgttttctggggtaagagctagcaaccgaatcttgtatttcccacacagatccacggcaactgtcagcaacattgctgcgagtacttgatactgtatcagtgtattgcatctattgttggtgatcactgtgtagatcgacaagggtccaaaccgaccacggcgataagccatgcgtcgtctgggactttcccttcaccacgacacgagtccaagcttcgctgcccttgcttgcaaccagcggccgccaccgaatggcaccgttcacgcgtgctccaaaagccgcccacctcagttggagccgggaaaagttggcaaaaagccaataaaaaagacgatgcgcattgcccggattcccacttcgatcccccctcaccttcgtcttcctctcgacctctccgctgtctctccgatgggctcagcttcaggtgagcgagtacacctcgtcgtctcttgtgcgtcagcttcgtgttccagtgtacgtgctgacgacatgtgcgtgtgatcaacgatcgaatttgaagagcatgatgtcagggagcacctgctggacgtggacggcgtcggggaagaaggggcggcggcggcggcggggccgaagatacgggtgcgggggctgacgcggcggtcggaggcgagaggcgaggagatcctgcggggcgtcgacctggacgtgccgcgcggggtggtcgtcggcgtcatcggccccagcggcagcggcaagtccacgctgctccgcgcgctcaaccgcctctgggagcccgcgccgggcgccgtgctcctcgacggcgtcgacatctgcggcatcgacgtcctcgcgctccgccggaaggtcggcatgctcttccagctccccgccatgttcgacggtaagtacgtacgcccgccgctgtccacacacactgcacatacgcacggtgatccgatcctggaagaaactgtacatggattccatgaatgcggtaccttttccaaatttaaatgttcttctctgcaaaaagatgcttttccttcaaaaataaacaagaacttgatttgagattaccaagatcctgtccaaaaaaaaaaacagtaacgagtaagttttagacgatcaacagacaactaggtttggcatttttcatatgaataattaactattcgccactcttacgattgattagcctagttgtgtcaataataagttataataagggggaaataatgataaaatgtaccaatgtcgcagtcaaaacctaacaaatgaaagccgagttatagcatttgataaacagataaaaccaagttgagcacttttttgccctcgtcttgtttcctagaaatgggtgataagtttttttctacctaagaaaccgcatcaattttcaacttgcagtgaacttttacactagaggacgggtacttttagttgaaagagtttttacgctaaggccaaatacatgagagcttttgctagttgtaacttcttctagactttatagctcccttaaatagttcagattctaacctaaattctgataattgatactcctcagtttgccagaatatttcaacctaggatgagacgactgtgaatctgaacattcgtatttctagtatgagattaaatccatcttagtttgttacattctgagacggaggtagtagatacaaaatatttttaaaaaatactagaaactagaagttgtgaaacttaacttttccaaattcttatctactcgctactcgtcaactgattattagaggcttaaacaaggtctaaagctagtgcaatgtacttgataaaatggatgcttaatttgtctaccaacgtaagtggaatcttgcttcaaatattttttttcttagaagatgtcactgcttgctaacgtcagttgagtgggacatgcatgtcaattggtacgcctctaccaacgtggcgatgagtaacctacagtaactagaatcttccaagctcgtggctgacgtttcaatgcgacagggggacttattctaagcaaaataacagagggcgttcaatatattatctagaaaaaaaaagtaaaaaacggtcaaatttcatatgattcatgacaaaaagaagttttaaaaagtcaaatttcataagactccgtgggattgtttaggggagcttaaattctaagaagcaacaggtaaggattcggctggtgagaatatgtagaaatttggaaaaacctagcttctgctctagtttattttttcattctacaactacaactcattttaatttgaagataaaaactattttgaaaagtatttttattgtgggagaaactacaactacccgaagctccctaaggttgtgtttgaaggtgcattttggaaacacttcctctatagcacacacaacaaaatgactcattagcacctaattaattaagtattaactaaagaaattgaataataaattaaagcaattttccaaagcaacctttccatagaatttttttttacaaaaaaacatatcgtttcgcagtttaggaaacgtgcacgtaaaaaagagagtaaaaattggaacagcttaaaaattgtagttaagaacacacccttaatatgccaggttttccaaagctataattttaattttttattccaagttaaaattgattcaacagatccgatctactctggcacactccatttccccattgagtcctatttttctcatttgaggcacatggctcaagtatatatccccccagatgcaaaagctcaatgcaccaaacacagatttgacaggagtatttgatatttctcatgcaaaaaaactgaagtggtctgacacttgtgccaggaaccgtggctgacaacgtgcgatacgggccacagctgcagggcaagaagctgacggacgccgaggtgcagagcctactgagcctcgccgacctggaccctgctctctgctccaagcccgcctccgagctctccgtcggccaggcgcagcgcgtcgcattggctcgcaccctcgccaacgatccggaggcatgttggattattcagccttttcgctgattgcaacgcgacgcatcttggtgtttcggattcaggatcggattctgatgttggagtgtgtgtgcaggtgcttctgctggatgagccgacgagcgcgttggatcccatctcgacgcagaacatcgaggaggcgatcgtgcggctgaagaagacgagggggctcaccacggtgatggtgtcgcacagcgtgaagcagatccagcggatcgccgacctggtctgcctcctcgtcgccggcgaggtcgtcgaggtgctcccgccgtcggagctgtccgaggccaagcaccccatggcacggcgcttcctcgagctcagctgaagactggcacgacgatctcctcctcctctgtatgacgcttcttccgtttgtgtgattcggatgtgtacctgtaatcttgagaagttgagattatgcctgtatactatgtcggaaattttgtggtgagatgatctcaaccctactggccataaaatgcattttggtaaatattcttttatctaaaccctagtggcctccgaggctccgacattgtatttttgcctgtaatattggtacactactaaaatgaaatttggtactccctccgtcccagattataagggatttt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064988.1 RefSeq:Os06g0695800]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Os06g0695800 is the gene STAR1 which is responsible for Al tolerance in rice.
Annotated Information
Function
Map-Based Cloning and Complementation of STAR1.
STAR1 sequence, conserved motifs and star1 mutation.
Aluminum (Al) toxicity is a major factor limiting crop production in acidic soil, but the molecular mechanisms of Al tolerance are poorly understood. The gene STAR1(for sensitive to Al rhizotoxicity1) is responsible for Al tolerance in rice. Proteins encoded by STAR1 form a complex that functions as a unique ATP binding cassette (ABC) transporter, which is required for detoxification of Al in rice. The results described that STAR1 is translated to NBD, respectively, and then functions as an ABC transporter protein complex.[1] However, the function of most ABC transporters is still unknown.
Expression
Expression Analysis of STAR1and STAR2.
Expression of STAR1 in different root segments.
STAR1 is mainly expressed in the roots, and mRNA accumulation of STAR1 is significantly enhanced when seedlings were exposed to aluminum. A time-course experiment showed that the expression of STAR1 was similarly induced by aluminum as early as 2h after the exposure. Furthermore, an aluminum concentration as low as 5μM triggered the expression of STAR1, and the expression level increased with increasing external aluminum concentration[1]. The mRNA accumulation of STAR1 does not respond to low pH and other metals, indicating that STAR1 is specifically induced by aluminum.
Evolution
There is no homolog of STAR1 in the rice genome. STAR1 also showed similarity to the NBD subunit of the bacterial phosphate transporter, pstB, and the similarity to this transporter is higher than any other plant ABC transporters[1].
Labs working on this gene
·Research Institute for Bioresources, Okayama University, Kurashiki 710-0046, Japan.
·QTL Genomics Research Center, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.
·Genome Resource Center, Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.
References
- ↑ 1.0 1.1 1.2 Chao Feng Huang, Naoki Yamaji, Namiki Mitani, et.al. (2009) A Bacterial-Type ABC Transporter Is Involved in Aluminum Tolerance in Rice. The Plant Cell, Vol. 21: 655-667.
Structured Information