Difference between revisions of "Os06g0727200"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
Catalase isozyme B ('''''OsCATB''''') plays a pivotal role in '''response to water stress'''<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*Water stress-induced ABA '''prevents the excessive accumulation of H<sub>2</sub>O<sub>2</sub>''', through the induction of the expression of ''CATB'' gene during water stress. ''OsCATB'' is '''significantly induced by ABA''' and plays a '''key role in controlling H<sub>2</sub>O<sub>2</sub> accumulation''' under water stress<ref name="ref1"/>.
 +
 
 +
*'''In other words''', water stress induced rapid accumulation of ABA in and  H<sub>2</sub>O<sub>2</sub>mediated by ABA as a key regulator in rice leaves. ABA not only mediates the accumulation of H<sub>2</sub>O<sub>2</sub>, but also indirectly controls H<sub>2</sub>O<sub>2</sub> level by regulating the expression of ''OsCATB''<ref name="ref1"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004096 GO:0004096],[http://amigo.geneontology.org/amigo/term/GO:0006118 GO:0006118], [http://amigo.geneontology.org/amigo/term/GO:0006979 GO:0006979]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*The '''''CATB'' gene''' is '''mainly''' expressed in '''seed and root''' with rather a '''low''' level of expression in rice '''leaves'''<ref name="ref1"/>. As for ''OsCATB'', high expression was observed in the '''panicles''', '''leaf sheaths''', and '''culms'''. In leaves, ''OsCATA'' and ''NOE1/OsCATC'' were '''highly''' expressed but ''OsCATB'' was much '''less abundant'''<ref name="ref2"/>.
 +
 
 +
*''OsCATC'' is the photorespiration CAT located in the peroxisome while ''OsCATB'', which also '''bears a peroxisomal targeting signal near the C terminus''', tends to be expressed in root and seed; the '''decomposition of photorespiration-associated H<sub>2</sub>O<sub>2</sub>''' seems unlikely to be the result of ''OsCATB'' gene expression<ref name="ref1"/>.
 +
 
 +
*The expression of both ''CATA'' and ''CATC'' is significantly suppressed by water stress whereas the ''CATB'' transcript is '''induced by water stress''', which indicating that the ''OsCATB'' gene may play an important role under water stress<ref name="ref1"/>.
 +
 
 +
*Real-time quantitative PCR analysis revealed that the expression of ''OsCATA'', ''OsCATB'', and ''NOE1''/''OsCATC'' varied in different tissues<ref name="ref2"/>.
 +
 
 +
*In addition, no compensatory induction of ''OsCATA'' and ''OsCATB'' transcripts was observed in ''noe1'' plants<ref name="ref2"/>. ''CatB'' has a '''promoter region''' that shows preferential expression in the '''roots''' during root development of rice. The –329 to +298 region of ''CatB'' could be useful for expressing transgenes preferentially in the roots of not only monocots such as rice but of dicots such as ''Arabidopsis''<ref name="ref3"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: CAT protein phylogenic1.jpg|right|thumb|250px|'''Figure 1.''' ''Phylogenetic analysis of CAT protein sequences.(from reference <ref name="ref1"/>).'']]
 +
*Fig. 1 shows the polygenetic analysis of ''OsCAT'' genes in comparison with CAT gene families of other plant species. Except for the dicot ''Arabidopsis'' CAT genes, the other monocot CAT genes are '''classified into three groups'''<ref name="ref1"/>.
 +
 
 +
*'''Two orthologs''' of ''OsCATB'', ''CAT1'' from maize and ''CAT2'' from wheat, were proved to be induced by water stress<ref name="ref4"/><ref name="ref5"/>, which indicating that ''CATC'' gene is responsible for scavenging photorespiration-associated H<sub>2</sub>O<sub>2</sub> production and CATB gene plays a pivotal role in response to water stress<ref name="ref1"/>.
 +
 
 +
*''NOE1''/''OsCATC'' encodes the rice catalase domain-containing protein and has '''extremely high sequence similarity with''' catalase isozyme A (''OsCATA'') and catalase isozyme B (''OsCATB'') in rice and three catalase isozymes in ''Arabidopsis''<ref name="ref2"/>.
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
The production of both ABA and H<sub>2</sub>O<sub>2</sub> is induced by drought and can act as signals under stress conditions. As a key gene in ABA biosynthesis, ''OsNCED3'' was significantly induced in rice by water stress treatment and such induction preceded the rapid increase in ABA. Water stress inhibited the expression of ''CATA'' and ''CATC'' but substantially enhanced the expression of ''CATB''. Exogenously applied ABA promoted the expression of ''CATB'' also and inhibited the expression of ''CATC'' in a concentration-dependent manner<ref name="ref1"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Department of Biology, Hong Kong Baptist University, Hong Kong, China
 +
*College of Life Science, South China Agricultural University, Guangdong, China
 +
*State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, China
 +
*State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology
 +
*Proteomics Platform, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101, China
 +
*Institute of Molecular Plant Sciences, School of Biological Sciences, University of Edinburgh, Edinburgh EH9 3JR, United Kingdom
 +
*Graduate School of the Chinese Academy of Sciences, Beijing 100049, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Ye N, Zhu G, Liu Y, et al. ABA controls H2O2 accumulation through the induction of OsCATB in rice leaves under water stress[J]. Plant and cell physiology, 2011, 52(4): 689-698.
 +
</ref>
 +
* <ref name="ref2">
 +
Lin A, Wang Y, Tang J, et al. Nitric oxide and protein S-nitrosylation are integral to hydrogen peroxide-induced leaf cell death in rice[J]. Plant Physiology, 2012, 158(1): 451-464.
 +
</ref>
 +
* <ref name="ref3">
 +
Iwamoto M, Higo H, Higo K. Strong expression of the rice catalase gene CatB promoter in protoplasts and roots of both a monocot and dicots[J]. Plant Physiology and Biochemistry, 2004, 42(3): 241-249.
 +
</ref>
 +
* <ref name="ref4">
 +
Guan L M, Scandalios J G. Hydrogen peroxide-mediated catalase gene expression in response to wounding[J]. Free Radical Biology and Medicine, 2000, 28(8): 1182-1190.
 +
</ref>
 +
* <ref name="ref5">
 +
Luna C M, Pastori G M, Driscoll S, et al. Drought controls on H2O2 accumulation, catalase (CAT) activity and CAT gene expression in wheat[J]. Journal of experimental botany, 2005, 56(411): 417-423.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0727200|
 
Description = Catalase isozyme B (EC 1.11.1.6) (CAT-B)|
 
Version = NM_001065170.1 GI:115470071 GeneID:4342124|
 
Length = 3892 bp|
 
Definition = Oryza sativa Japonica Group Os06g0727200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:31821287..31825178|
 
CDS = 31821391..31821405,31821522..31821618,31822530..31822807,31823159..31823935,31824157..31824246<br>,31824441..31824508,31824599..31824692,31824805..31824864|
 
GCID = <gbrowseImage1>
 
name=NC_008399:31821287..31825178
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:31821287..31825178
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggatccctacaagcatcggccgtccagcgggagcaattccaccttctggaccaccaactccggcgcccccgtctggaacaacaactccgccctcaccgtcggagagcgaggccctatcctccttgaggactatcatctgattgaaaagcttgcacagtttgacagggagcgtatccctgaacgtgtcgttcatgcaaggggagccagtgccaagggattttttgaggttactcatgatatttctcacctcacatgtgctgattttctccgtgctcctggtgttcagaccccagttattgttcggttctccacagtcgtgcatgagcgtggaagccctgagacattgagggatccacgtggttttgctgtcaagttttacactagagagggtaattttgatcttgttgggaacaatatgcctgtcttttttatccgagatgggatgaaattccctgacatggtccatgctttcaagccaagtccaaagaccaatatgcaggagaactggagaatagttgatttcttttcacaccacccagagagcctgcacatgttctccttcctctttgacgatgtaggcatcccactcaactacaggcacatggagggttttggtgtcaacacctacaccctaatcaataaggatggaaagcctcaccttgtcaaattccactggaagcctacctgtggtgtcaaatgcctgttggatgatgaagctgtgactgttggcggcacctgccacagccatgccacgaaggacttgactgattctattgcagcagggaattacccagagtggaagctttacatccagactattgatcctgatcatgaggacagatttgacttcgatcctcttgatgtcaccaagacatggccagaggatatcatccccctgcagccagttggacggatggtcctgaacaaaaacattgataacttctttgcagaaaatgaacagcttgctttctgcccagcgataattgtccctggaatccattactctgatgataagctgctccagacaagaattttctcctatgctgatacccaaaggcaccgtcttggcccaaactatttgatgcttcctgtgaatgcaccaaaatgtgcataccacaacaaccaccacgatggctccatgaatttcatgcacagggatgaagaggttaactacttcccttcaaggtttgatgctgcacgtcatgctgagaaggtccctattcctcctcgtgttctaacaggctgtcgggaaaagtgtgtcattgacaaggagaacaatttccaacaggctggtgagagataccggtcatttgaccctgccaggcaagatcgttttctccagcggtgggttgatgctctctcagatcctcgtattacacatgaactccgtggcatctggatctcctactggtcgcagtgtgatgcgtcccttgggcagaagctggcttcacgtctcaacctgaaaccaaacatgtag</cdnaseq>|
 
AA = <aaseq>MDPYKHRPSSGSNSTFWTTNSGAPVWNNNSALTVGERGPILLED                    YHLIEKLAQFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVR                    FSTVVHERGSPETLRDPRGFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKP                    SPKTNMQENWRIVDFFSHHPESLHMFSFLFDDVGIPLNYRHMEGFGVNTYTLINKDGK                    PHLVKFHWKPTCGVKCLLDDEAVTVGGTCHSHATKDLTDSIAAGNYPEWKLYIQTIDP                    DHEDRFDFDPLDVTKTWPEDIIPLQPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIH                    YSDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNY                    FPSRFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRW                    VDALSDPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM</aaseq>|
 
DNA = <dnaseqindica>105..119#236..332#1244..1521#1873..2649#2871..2960#3155..3222#3313..3406#3519..3578#cttctctcctcgtccttatcaccaccaatccgatcctcttctcttctcttctcttcttccccacatccagttcgattctcatctctcccacaacaaatcacgccatggatccctacaaggtgccgccttttcctgattttcttttcttctagatcgatcgtcgatttggtttggtttggtttcttgatgcgctcatcccaatctgactgactcactggattcctcctccttgcagcatcggccgtccagcgggagcaattccaccttctggaccaccaactccggcgcccccgtctggaacaacaactccgccctcaccgtcggagagcgaggtactgagctgctccatcctccatcttcctcatctcttcctccacgaatctatacttcctatcgatccatgtgctttatgtctgcttagaggcgtatttgggcttgcttccatcatgatccaatgttaactttgagcgatcagatgcttaataatttgtctgtgtctggtagcaacagaaaaggtccctggatctgtgtgaattggactgtagcacgacgtgtgcgatcttgccttactattgttcctttagagctattcaaagtttgcatctttggtgtgggggggttttcagccttttgctttgagtaacatgtccttgtcactaccttgtgattcatctgtgctgcttacacacaaagaggaagatctctagtttggttgcactatgttcttgttattgctcggttacactccttcatcaacgctaaaagacgcagtcttgatatttttctctgtcgctgtcaatctgtcataccattaataaagaacgtataaaaattgaccttttccccattcatagtagtgattatctcacttgtcctcagttctaaaacagcattcttgttttttgggggtttttttaccattatcggttcactttacaaagtaatctgatgacgatcaaatttactggagtaccagagaagcacaagtctatttcatacatatatccaacatgactcaagtttcgaaagtgactggaagtcatgttccaaatgtcatggtcactaaaagtaccaaactctgacaaagatgtatttgcatctagaactaagtgcttctatcatcgatctgtgaagttttctttctagtgttttccctttatttatactcagcaactcctgtatttttgcaatctgtaatcatggctgttttgtggtttgacatgatgaattcttcaatcgacaggccctatcctccttgaggactatcatctgattgaaaagcttgcacagtttgacagggagcgtatccctgaacgtgtcgttcatgcaaggggagccagtgccaagggattttttgaggttactcatgatatttctcacctcacatgtgctgattttctccgtgctcctggtgttcagaccccagttattgttcggttctccacagtcgtgcatgagcgtggaagccctgagacattgagggatccacgtggttttgctgtcaagttttacactagagaggtacttgctctttcgcttctttctttcataggattgtaggagggagacattcagtataatgtattcttcaagcataaggctgtagaatcaaatgtctagttgttctcagttggttaagtagaacatgaaagattggttgtcctttacctccacactccataggtccagtgcattgcttaatcttatatctactaaagcaaatgagggtaatttggtcttatatatctcaaaagtctcacacattggacatatatctaaccagtgtcacctacaactttgtcttactgtttatttactgatttgcattcagtgctgccatattttgatattttctgagtcaatgcttttcagggtaattttgatcttgttgggaacaatatgcctgtcttttttatccgagatgggatgaaattccctgacatggtccatgctttcaagccaagtccaaagaccaatatgcaggagaactggagaatagttgatttcttttcacaccacccagagagcctgcacatgttctccttcctctttgacgatgtaggcatcccactcaactacaggcacatggagggttttggtgtcaacacctacaccctaatcaataaggatggaaagcctcaccttgtcaaattccactggaagcctacctgtggtgtcaaatgcctgttggatgatgaagctgtgactgttggcggcacctgccacagccatgccacgaaggacttgactgattctattgcagcagggaattacccagagtggaagctttacatccagactattgatcctgatcatgaggacagatttgacttcgatcctcttgatgtcaccaagacatggccagaggatatcatccccctgcagccagttggacggatggtcctgaacaaaaacattgataacttctttgcagaaaatgaacagcttgctttctgcccagcgataattgtccctggaatccattactctgatgataagctgctccagacaagaattttctcctatgctgatacccaaaggcaccgtcttggcccaaactatttgatgcttcctgtgaatgcaccaaaatgtgcataccacaacaaccaccacgatggctccatgaatttcatgcacagggatgaagaggtactgtgtgtatatactttcagagatacatctcctgcattcagttgttgtgatgcatctttctgtttttgtccattacatattgtttcttccagtcaacacaaacagaatgggactatcattcagtttattgcatttacatctatttgccttgtttttaggttaactacttcccttcaattcagtttattgcatttacatctatttgccttgttttttaggttaactacttcccttcaaggtttgatgctgcacgtcatgctgagaaggtccctattcctcctcgtgttctaacaggctgtcgggaaaaggtgtgtaacttggtccacttgaactccttgcgctgttaccttgtgagcatggttttgtcccgctacattaggagactatttgctgatttggaatgcgatgaaatatgtattatagatgtggtaccctggaaagtacaatgaccacatgcatttgacacaatgttttctgcctctcttttttgttggaaatgcagtgtgtcattgacaaggagaacaatttccaacaggctggtgagagataccggtcatttgaccctgccaggtttgttcttgttcaatttaattcgtgtgaacacatcgaagagtttgagcaacaacgctaattaaacttttctttttgtatgtaacacaggcaagatcgttttctccagcggtgggttgatgctctctcagatcctcgtattacacatgaactccgtggcatctggatctcctactggtcgcaggtaacataatttcttcgtgggtgcaaagtgcttatcagttgtcagtgagagatcatgtacaattgtaccttgtattgacacactgaaaccatatatttgtgtgttgttgcagtgtgatgcgtcccttgggcagaagctggcttcacgtctcaacctgaaaccaaacatgtagatcggccaggaggaatccagtggtggtgctatgttggacagtcaaacatgaactgtaatgtgtcgaccagccgtagtcgtgaataaaatgtgatacggtgatatgtatactggtgacgcaagttgtgaaactgtatctggaatcctgaaaatatgccttgctgtgtcttgggaaagagataataaagactgatacagtgggtgctatatgtttgaacttgtttatacatctgccatctcttgtttgcctttgtgttaagatggctttagagactggaacgaacaaccagctgtttgcctttgtgcctttgtgtt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001065170.1 RefSeq:Os06g0727200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:27, 12 June 2015

Catalase isozyme B (OsCATB) plays a pivotal role in response to water stress[1].

Annotated Information

Function

  • Water stress-induced ABA prevents the excessive accumulation of H2O2, through the induction of the expression of CATB gene during water stress. OsCATB is significantly induced by ABA and plays a key role in controlling H2O2 accumulation under water stress[1].
  • In other words, water stress induced rapid accumulation of ABA in and H2O2mediated by ABA as a key regulator in rice leaves. ABA not only mediates the accumulation of H2O2, but also indirectly controls H2O2 level by regulating the expression of OsCATB[1].


GO assignment(s): GO:0004096,GO:0006118, GO:0006979

Expression

  • The CATB gene is mainly expressed in seed and root with rather a low level of expression in rice leaves[1]. As for OsCATB, high expression was observed in the panicles, leaf sheaths, and culms. In leaves, OsCATA and NOE1/OsCATC were highly expressed but OsCATB was much less abundant[2].
  • OsCATC is the photorespiration CAT located in the peroxisome while OsCATB, which also bears a peroxisomal targeting signal near the C terminus, tends to be expressed in root and seed; the decomposition of photorespiration-associated H2O2 seems unlikely to be the result of OsCATB gene expression[1].
  • The expression of both CATA and CATC is significantly suppressed by water stress whereas the CATB transcript is induced by water stress, which indicating that the OsCATB gene may play an important role under water stress[1].
  • Real-time quantitative PCR analysis revealed that the expression of OsCATA, OsCATB, and NOE1/OsCATC varied in different tissues[2].
  • In addition, no compensatory induction of OsCATA and OsCATB transcripts was observed in noe1 plants[2]. CatB has a promoter region that shows preferential expression in the roots during root development of rice. The –329 to +298 region of CatB could be useful for expressing transgenes preferentially in the roots of not only monocots such as rice but of dicots such as Arabidopsis[3].

Evolution

Figure 1. Phylogenetic analysis of CAT protein sequences.(from reference [1]).
  • Fig. 1 shows the polygenetic analysis of OsCAT genes in comparison with CAT gene families of other plant species. Except for the dicot Arabidopsis CAT genes, the other monocot CAT genes are classified into three groups[1].
  • Two orthologs of OsCATB, CAT1 from maize and CAT2 from wheat, were proved to be induced by water stress[4][5], which indicating that CATC gene is responsible for scavenging photorespiration-associated H2O2 production and CATB gene plays a pivotal role in response to water stress[1].
  • NOE1/OsCATC encodes the rice catalase domain-containing protein and has extremely high sequence similarity with catalase isozyme A (OsCATA) and catalase isozyme B (OsCATB) in rice and three catalase isozymes in Arabidopsis[2].

Knowledge Extension

The production of both ABA and H2O2 is induced by drought and can act as signals under stress conditions. As a key gene in ABA biosynthesis, OsNCED3 was significantly induced in rice by water stress treatment and such induction preceded the rapid increase in ABA. Water stress inhibited the expression of CATA and CATC but substantially enhanced the expression of CATB. Exogenously applied ABA promoted the expression of CATB also and inhibited the expression of CATC in a concentration-dependent manner[1].

Labs working on this gene

  • Department of Biology, Hong Kong Baptist University, Hong Kong, China
  • College of Life Science, South China Agricultural University, Guangdong, China
  • State Key Laboratory of Crop Biology, College of Life Sciences, Shandong Agricultural University, China
  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology
  • Proteomics Platform, Institute of Biophysics, Chinese Academy of Sciences, Beijing 100101, China
  • Institute of Molecular Plant Sciences, School of Biological Sciences, University of Edinburgh, Edinburgh EH9 3JR, United Kingdom
  • Graduate School of the Chinese Academy of Sciences, Beijing 100049, China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Ye N, Zhu G, Liu Y, et al. ABA controls H2O2 accumulation through the induction of OsCATB in rice leaves under water stress[J]. Plant and cell physiology, 2011, 52(4): 689-698.
  2. 2.0 2.1 2.2 2.3 Lin A, Wang Y, Tang J, et al. Nitric oxide and protein S-nitrosylation are integral to hydrogen peroxide-induced leaf cell death in rice[J]. Plant Physiology, 2012, 158(1): 451-464.
  3. Iwamoto M, Higo H, Higo K. Strong expression of the rice catalase gene CatB promoter in protoplasts and roots of both a monocot and dicots[J]. Plant Physiology and Biochemistry, 2004, 42(3): 241-249.
  4. Guan L M, Scandalios J G. Hydrogen peroxide-mediated catalase gene expression in response to wounding[J]. Free Radical Biology and Medicine, 2000, 28(8): 1182-1190.
  5. Luna C M, Pastori G M, Driscoll S, et al. Drought controls on H2O2 accumulation, catalase (CAT) activity and CAT gene expression in wheat[J]. Journal of experimental botany, 2005, 56(411): 417-423.

Structured Information