Difference between revisions of "Os07g0182900"

From RiceWiki
Jump to: navigation, search
(Sequence comparison between OsMET1a and OsMET1b)
(Structured Information)
 
(32 intermediate revisions by 4 users not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
DNA methylation is a heritable epigenetic mark that regulates expression of genes involved in developmental processes DNA. In mammals, DNA methylation predominantly occurs in CG dinucleotides and is maintained by DNA methyltransferase1, While in plants, CG methylation
+
DNA methylation is a heritable epigenetic mark that regulates expression of genes involved in developmental processes<ref name="ref1" />. In mammals, DNA methylation predominantly occurs in CG dinucleotides and is maintained by DNA methyltransferase1, While in plants, CG methylation is maintained by methyltransferase1(MET1)<ref name="ref1" />. Methytransferase (OsMET1) genes from rice (Oryza sativa L) have two types, OsMET1a and OsMET1b, on chromosomes 3 and 7, respectively, each encoding a cytosine-5 DNA methyltransferase (MTase), which are mainly responsible for maintaining CG dinucleotide methylation after DNA replication<ref name="ref1" /><ref name="ref2" />.OsMET1 is a plant homolog of mammalian DNA methyltransferase1(DNMT1), and MET1b plays a major role in the maintenance DNA methylation compared to MET1a, which is indispensable for the normal development of embryos in rice<ref name="ref1" />.
is maintained by methyltransferase1(MET1).DNA methytransferase (OsMET1) genes from rice (Oryza sativa L) have two types, OsMET1a and OsMET1b, on chromosomes 3 and 7, respectively, each encoding a cytosine-5 DNA methyltransferase (MTase), which are mainly responsible for maintaining CG dinucleotide methylation after DNA replication.OsMET1 is a plant homolog of mammalian DNA methyltransferase1(DNMT1), and MET1b plays a major role in the maintenance DNA methylation compared to MET1a, which is indispensable for the normal development of embryos in rice.
 
  
 
===Sequence comparison between OsMET1a and OsMET1b===
 
===Sequence comparison between OsMET1a and OsMET1b===
*OsMET1a has an open reading frame of 4,566 nucleotides with 12 exons and 11 introns while OsMET1b has an open reading frame of 4,491; nucleotides with 11 exons and 10 introns. Although OsMET1a and OsMET1b have high sequence similarity overall, they share only 24%; dentity in exon 1, and intron 3 of OsMET1a is absent from OsMET1b.
+
*OsMET1a has an open reading frame of 4,566 nucleotides with 12 exons and 11 introns while OsMET1b has an open reading frame of 4,491; nucleotides with 11 exons and 10 introns. Although OsMET1a and OsMET1b have high sequence similarity overall, they share only 24%; dentity in exon 1, and intron 3 of OsMET1a is absent from OsMET1b.<ref name="ref2" />
*A lysine–glycine repeat that is highly conserved in DNA MTases is present two-thirds of the way through the protein, separating the catalytic and regulatory domains in both OsMET1a and OsMET1b.
+
*A lysine–glycine repeat that is highly conserved in DNA MTases is present two-thirds of the way through the protein, separating the catalytic and regulatory domains in both OsMET1a and OsMET1b.<ref name="ref2" />
*The amino acid sequence downstream of the lysine–glycine repeat motif in OsMET1a showed a higher conservation (86.5%) with that of OsMET1b than did that (67.7%) for the N terminal domain (residues 1–1059). The inferred amino acid sequences of OsMET1a and OsMET1b contain several functional regions.
+
*The amino acid sequence downstream of the lysine–glycine repeat motif in OsMET1a showed a higher conservation (86.5%) with that of OsMET1b than did that (67.7%) for the N terminal domain (residues 1–1059). The inferred amino acid sequences of OsMET1a and OsMET1b contain several functional regions.<ref name="ref2" />
 +
[[File:112233.JPEG]]
 +
 
 +
Figure 1:Proportionate diagram of OsMET1-1 showing conserved domains: S-stretch serine-rich region; E-rich region glutamic acid-rich region; BAH bromo adjacent homology domain (black boxes with white dots); IQ motif (calmodulin binding) isoleucine (I) and glutamine (Q) motif (hatched box); NLS putative nuclear localization signal (oval); KG linker the lysine-glycine repeat, KNKGKG (gray box); I to X the catalytic domain with eight highly conserved DNA MTase motifs (black bars).<ref name="ref2" />
  
 
===Mutation assay===
 
===Mutation assay===
* RNAi-mediated  knockdown  analysis of the rice MET1 genes showed that it resulted in reactivation of a silenced β-glucuronidase (GUS) transgene in rice callus.
+
* RNAi-mediated  knockdown  analysis of the rice MET1 genes showed that it resulted in reactivation of a silenced β-glucuronidase (GUS) transgene in rice callus.<ref name="ref1" />
* A Osmet1a null mutant has no obvious phenotypes, while Osmet1b null mutant exhibited abnormal seed phenotypes, such as early embryonic lethality, decreased levels of DNA methylation at repetitive CentO sequences and at the FIEI gene locus in the embryos.
+
* A Osmet1a null mutant has no obvious phenotypes, while Osmet1b null mutant exhibited abnormal seed phenotypes, such as early embryonic lethality, decreased levels of DNA methylation at repetitive CentO sequences and at the FIEI gene locus in the embryos.<ref name="ref1" />
 
[[File:Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds.png]]
 
[[File:Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds.png]]
  
Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds
+
Figure 2.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds<ref name="ref1" />
  
 
===Expression===
 
===Expression===
 
* Ribonuclease protection assays showed that MET1a and MET1b both express in highly replicating and dividing cells;
 
* Ribonuclease protection assays showed that MET1a and MET1b both express in highly replicating and dividing cells;
* MET1b is more abundantly expressed than MET1a in all of the tissues examined, like callus, root and inflorescence.
+
* MET1b is more abundantly expressed than MET1a in all of the tissues examined, like callus, root and inflorescence;
* OsMET1b does not express in differentiated tissue (10-day-old leaf), and no expression for either gene was found in mature leaves.
+
* OsMET1b does not express in differentiated tissue (10-day-old leaf), and no expression for either gene was found in mature leaves.<ref name="ref2" />
  
 
===Evolution===
 
===Evolution===
This phylogenetic relationships between eukaryotic and prokaryotic DNA methytransferase were derived using the AlignX program of the VectorNTI suite, suggesting that the rice DNA methytransferase are related to DNA methytransferase of Dnmt1/MET1 class in diverse organisms from several kingdom.
+
This phylogenetic relationships between eukaryotic and prokaryotic DNA methytransferase were derived using the AlignX program of the VectorNTI suite, suggesting that the rice DNA methytransferase are related to DNA methytransferase of Dnmt1/MET1 class in diverse organisms from several kingdom.<ref name="ref2" />
 +
[[File:112233cwb.jpeg]]
 +
 
 +
Figure 3. Phylogenetic relationships between eukaryotic and prokaryotic DNA methytransferase
 +
Phylogenetic relationships between eukaryotic and prokaryotic MTases were derived using the AlignX program of the VectorNTI suite with the following GenBank accessions: maize MET1 (AF063403), rice MET1-1 (OsMET1-1, AF462029), rice MET1-2 (OsMET1-2, TPA BK001405), Arabidopsis MET1(AtMET1, AT5G49160) and MET2 (MET2-type C-5 DNA MTase, AT4G08990), pea MET1 (putative C-5 DNA MTase, AF034419), carrot MET1 (carrot C-5 DNA MTase, AF007807) and MET2 (MET2-type C-5 DNA MTase, AF007808), tobacco MET1 (NtMET1, AB030726), tomato (putative C-5 DNA MTase AJ002140), rat DNMT1 (AB012214), human DNMT1 (AF180682), Xenopus DNMT1(D78638), zebra fish DNMT1 (AF483203), chicken DNMT1 (2112268A), Neurospora DIM2 (AF348971), Ascobolus DNMTase (Z96933), rice MET2a (AC069324), maize MET2a (AF243043) and Haemophilus haemolyticus M.HhaI (XYH1H1)<ref name="ref2" />
 +
 
 +
===Knowledge extension===
 +
Apart from the main information listed above about function, expression and evolution about OsMET1 gene<ref name="ref1" /><ref name="ref2" />, there are also some advanced researches about this gene being conducted in the past few years<ref name="ref3" /><ref name="ref4" /><ref name="ref5" />. Takaki Yamauchi et al. reported in 2007 that the alternative splicing mechanisms of OsMET1a transcript and OsMET1b transcript differ, which is key to the regulation of active OsMET1 protein generation in different tissues<ref name="ref3" />. Daisuke Miki et al. reported in 2008 that de novo DNA methylation can be induced by siRNA targeted to endogenous transcribed sequences which is gene-specific and OsMET1-indepent in rice, which is also the first time to observe transcriptional gene silencing by siRNAs<ref name="ref4" />. Takaki Yamauchi et al. reported in 2009 that they successfully realized homologous recombination-promoted knock-in targeting to monitor gene expression by fusing a reporter gene named GUS codingβ-glucuronidase with its promoter in rice, in principle, this method can be applied to modify any endogenous gene which would promote basic and applied plant research<ref name="ref5" />.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Institute of Developmental and Molecular Biology, and Department of Biology, Texas A&M University, College Station, TX, USA
 +
* National Institute for Basic Biology, Okazaki, Japan
 +
* Graduate School of Science and Technology, Chiba University, Matsudo, Japan
 +
* Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Japan
 +
* Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, Shizuoka, Japan
 +
* Faculty of Agriculture, Meijo University, Nagoya, Japan
 +
* Graduate School of Horticulture, Chiba University, Matsudo, Japan
 +
* Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology (NAIST), Ikoma, Japan
 +
* Graduate School of Agriculture and Life Sciences, University of Tokyo, Tokyo, Japan
 +
* Department of Basic Biology, School of Life Science, The Graduate University for Advanced Studies, Okazaki, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">Takaki Yamauchi et al. The MET1b gene encoding a maintenance DNA methyltransferase
 +
is indispensable for normal development in rice. Plant Mol Biol(2014) 85:219–232.</ref>
 +
<ref name="ref2">Prapapan Teerawanichpan et al. Characterization of two rice DNA methyltransferase genes
 +
and RNAi-mediated reactivation of a silenced transgene in rice callus. Planta(2004) 218:337-349.</ref>
 +
<ref name="ref3">Takaki Yamauchi et al. Alternative splicing of the rice OsMET1 genes encoding maintenance DNA methyltransferase. Jounal of Plant Physiology 165(2008) 1774-1782.</ref>
 +
<ref name="ref4">Daisuke Miki et al. De novo DNA methylation induced by siRNA targeted to endogenous transcribed sequences is gene-specific and OsMet1-independent in rice. The plant Jounal,(2008)56,539-549.</ref>
 +
<ref name="ref5">Takaki Yamauchi et al. Homologous recombination-mediated knock-in targeting of the MET1a gene for a maintenance DNA methyltransferase reproducibly reveals dosage-dependent spatiotemporal gene expression in rice. The plant Jounal(2009) 60, 386-396.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0182900|
 
Description = Similar to Cytosine-5 DNA methyltransferase MET1 (Fragment)|
 
Version = NM_001065587.1 GI:115470906 GeneID:4342575|
 
Length = 2298 bp|
 
Definition = Oryza sativa Japonica Group Os07g0182900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:4421779..4424076|
 
CDS = 4421780..4421864,4421955..4422066,4422154..4422301,4422417..4422614,4422710..4422988<br>,4423084..4423245,4423344..4423562,4423676..4423810|
 
GCID = <gbrowseImage1>
 
name=NC_008400:4421779..4424076
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:4421779..4424076
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>acaaaggtgtccaaagagaaccgtcttgcaactcttgacatttttgctggctgtggaggtttatcagaaggactgcagcaagctggtgtatcgtttacaaagtgggcgattgaatatgaggaaccagctggtgaagcatttaccaaaaatcatccagaagctgcggtgtttgtggataactgcaatgtgattttgaaggcaattatggacaaatgtggagatgctgatgattgcatttcaacttctgaggctgctgaacaagcagctaaattttctcaggacaatattatgaaccttcctgtccctggtgaagtagaattcataaatggtggtcctccatgtcagggcttttctgggatgaacagatttaaccaaagcccatggagtaaagttcaatgtgagatgattttagcattcctgtcttttgctgaatatttccgccccagattctttcttttagaaaatgttaggaactttgtttcattcaacaaaggacagacatttcgactgacagttgcatcccttctggagatgggataccaggtccggtttggaattttagaggcagggacttttggtgttgctcagtccaggaaaagagcattcatttgggctgctgcacctggagagactctgcctgattggccagaaccaatgcatgtgtttgctagccctgagctgaaaataaatttgcctgatggtaaatactatgcagctgcaaaaagcactgctggtggtgctcctttccgtgcaataacagttagagatacaataggcgatttaccaaaggtggagaatggcgccagtaaactcctacttgagtacggtggcgaacccatctcctggttccagaagaagattagagggaacacgatcgcgctgaatgatcacatatctaaggagatgaatgaactgaacctcatcagatgccaacgcattccaaagcggcctggttgtgattggcatgacctaccagatgagaaggtgaaactatcatctggccaactggtggacctgatcccttggtgcctgcctaacacagctaaaaggcacaaccagtggaaagggctttatggtaggctggattgggagggcaatttccctacttctgtgacagacccccagccaatgggcaaggttggcatgtgcttccaccctgaccaggataggatcatcacagtccgtgaatgtgcgcgatctcagggctttcctgacaactaccagttcgcgggcaacatccagagcaagcacaggcagattggcaatgcggtgcctccacctcttgccttcgccctcgggaggaaactgaaggaagctgttgatgcaaagcgtcagtag</cdnaseq>|
 
AA = <aaseq>TKVSKENRLATLDIFAGCGGLSEGLQQAGVSFTKWAIEYEEPAG                    EAFTKNHPEAAVFVDNCNVILKAIMDKCGDADDCISTSEAAEQAAKFSQDNIMNLPVP                    GEVEFINGGPPCQGFSGMNRFNQSPWSKVQCEMILAFLSFAEYFRPRFFLLENVRNFV                    SFNKGQTFRLTVASLLEMGYQVRFGILEAGTFGVAQSRKRAFIWAAAPGETLPDWPEP                    MHVFASPELKINLPDGKYYAAAKSTAGGAPFRAITVRDTIGDLPKVENGASKLLLEYG                    GEPISWFQKKIRGNTIALNDHISKEMNELNLIRCQRIPKRPGCDWHDLPDEKVKLSSG                    QLVDLIPWCLPNTAKRHNQWKGLYGRLDWEGNFPTSVTDPQPMGKVGMCFHPDQDRII                    TVRECARSQGFPDNYQFAGNIQSKHRQIGNAVPPPLAFALGRKLKEAVDAKRQ</aaseq>|
 
DNA = <dnaseqindica>2..86#177..288#376..523#639..836#932..1210#1306..1467#1566..1784#1898..2032#tacaaaggtgtccaaagagaaccgtcttgcaactcttgacatttttgctggctgtggaggtttatcagaaggactgcagcaagctggtatgcactttccttcaataatggtgtttagctttatcatcaacatgtcggccatcagactgatattttattaccatttaaattctgtaggtgtatcgtttacaaagtgggcgattgaatatgaggaaccagctggtgaagcatttaccaaaaatcatccagaagctgcggtgtttgtggataactgcaatgtgattttgaagtaggtgcaccgtgcacttccttgattttttctgtggttttctttttacctatatagctcaatagggactgttatatgattttgcagggcaattatggacaaatgtggagatgctgatgattgcatttcaacttctgaggctgctgaacaagcagctaaattttctcaggacaatattatgaaccttcctgtccctggtgaagtagaattcataaatggtggtcctccatgtcaggtatattattttgctatacttgatggaattttctttgcacctaggcaagcaaattgtttgcacttcaatacttgtgataaatgacttcaattttgtaatttttttctcaactcagggcttttctgggatgaacagatttaaccaaagcccatggagtaaagttcaatgtgagatgattttagcattcctgtcttttgctgaatatttccgccccagattctttcttttagaaaatgttaggaactttgtttcattcaacaaaggacagacatttcgactgacagttgcatcccttctggagatgggataccaggtaattattcttctggttatacatacttaaaatgcctatgtacagcatttgttttgaatcttataataaccagaagctgtttacttgttgcttaggtccggtttggaattttagaggcagggacttttggtgttgctcagtccaggaaaagagcattcatttgggctgctgcacctggagagactctgcctgattggccagaaccaatgcatgtgtttgctagccctgagctgaaaataaatttgcctgatggtaaatactatgcagctgcaaaaagcactgctggtggtgctcctttccgtgcaataacagttagagatacaataggcgatttaccaaaggtggagaatggcgccagtaaactcctacttgaggtaaaattgcttctcctatatggctatccgctccattttatcctgtttcttctcttgatttatatgctgaatgaatcccctcttttgtaatgcagtacggtggcgaacccatctcctggttccagaagaagattagagggaacacgatcgcgctgaatgatcacatatctaaggagatgaatgaactgaacctcatcagatgccaacgcattccaaagcggcctggttgtgattggcatgacctaccagatgagaaggtaaatgccatctaccttgcggttgcattcacttccttttgtgctcttccatacattccttgcatcagcggaatgttaaccattatgagcgtgtgcaggtgaaactatcatctggccaactggtggacctgatcccttggtgcctgcctaacacagctaaaaggcacaaccagtggaaagggctttatggtaggctggattgggagggcaatttccctacttctgtgacagacccccagccaatgggcaaggttggcatgtgcttccaccctgaccaggataggatcatcacagtccgtgaatgtgcgcgatctcaggtaagctgctattgctatccatccattcaacattctcttcctgtcttctaagatattgtgaatttggaggggagtcagtactgaccgtttaactaacctattcttgtctgcagggctttcctgacaactaccagttcgcgggcaacatccagagcaagcacaggcagattggcaatgcggtgcctccacctcttgccttcgccctcgggaggaaactgaaggaagctgttgatgcaaagcgtcagtaggtgctcagagtccttctccgatgatcgagggagatgattctcccctgaaaagaaacaaacaaccaaacatatgagtgtacttattttaattgtgcgctgcatttaactttgtgtgttgattaagattttagtcatatagatccttggtaaccttgtacattttagaggttgtgttgtgattgatacccttgattcaggggtatgatttagtggctgtattcagatatttaaacaaaataatactagttagtgatggttgaattgtt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001065587.1 RefSeq:Os07g0182900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:33, 12 June 2015

Please input one-sentence summary here.

Annotated Information

Function

DNA methylation is a heritable epigenetic mark that regulates expression of genes involved in developmental processes[1]. In mammals, DNA methylation predominantly occurs in CG dinucleotides and is maintained by DNA methyltransferase1, While in plants, CG methylation is maintained by methyltransferase1(MET1)[1]. Methytransferase (OsMET1) genes from rice (Oryza sativa L) have two types, OsMET1a and OsMET1b, on chromosomes 3 and 7, respectively, each encoding a cytosine-5 DNA methyltransferase (MTase), which are mainly responsible for maintaining CG dinucleotide methylation after DNA replication[1][2].OsMET1 is a plant homolog of mammalian DNA methyltransferase1(DNMT1), and MET1b plays a major role in the maintenance DNA methylation compared to MET1a, which is indispensable for the normal development of embryos in rice[1].

Sequence comparison between OsMET1a and OsMET1b

  • OsMET1a has an open reading frame of 4,566 nucleotides with 12 exons and 11 introns while OsMET1b has an open reading frame of 4,491; nucleotides with 11 exons and 10 introns. Although OsMET1a and OsMET1b have high sequence similarity overall, they share only 24%; dentity in exon 1, and intron 3 of OsMET1a is absent from OsMET1b.[2]
  • A lysine–glycine repeat that is highly conserved in DNA MTases is present two-thirds of the way through the protein, separating the catalytic and regulatory domains in both OsMET1a and OsMET1b.[2]
  • The amino acid sequence downstream of the lysine–glycine repeat motif in OsMET1a showed a higher conservation (86.5%) with that of OsMET1b than did that (67.7%) for the N terminal domain (residues 1–1059). The inferred amino acid sequences of OsMET1a and OsMET1b contain several functional regions.[2]

112233.JPEG

Figure 1:Proportionate diagram of OsMET1-1 showing conserved domains: S-stretch serine-rich region; E-rich region glutamic acid-rich region; BAH bromo adjacent homology domain (black boxes with white dots); IQ motif (calmodulin binding) isoleucine (I) and glutamine (Q) motif (hatched box); NLS putative nuclear localization signal (oval); KG linker the lysine-glycine repeat, KNKGKG (gray box); I to X the catalytic domain with eight highly conserved DNA MTase motifs (black bars).[2]

Mutation assay

  • RNAi-mediated knockdown analysis of the rice MET1 genes showed that it resulted in reactivation of a silenced β-glucuronidase (GUS) transgene in rice callus.[1]
  • A Osmet1a null mutant has no obvious phenotypes, while Osmet1b null mutant exhibited abnormal seed phenotypes, such as early embryonic lethality, decreased levels of DNA methylation at repetitive CentO sequences and at the FIEI gene locus in the embryos.[1]

Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds.png

Figure 2.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds[1]

Expression

  • Ribonuclease protection assays showed that MET1a and MET1b both express in highly replicating and dividing cells;
  • MET1b is more abundantly expressed than MET1a in all of the tissues examined, like callus, root and inflorescence;
  • OsMET1b does not express in differentiated tissue (10-day-old leaf), and no expression for either gene was found in mature leaves.[2]

Evolution

This phylogenetic relationships between eukaryotic and prokaryotic DNA methytransferase were derived using the AlignX program of the VectorNTI suite, suggesting that the rice DNA methytransferase are related to DNA methytransferase of Dnmt1/MET1 class in diverse organisms from several kingdom.[2] 112233cwb.jpeg

Figure 3. Phylogenetic relationships between eukaryotic and prokaryotic DNA methytransferase Phylogenetic relationships between eukaryotic and prokaryotic MTases were derived using the AlignX program of the VectorNTI suite with the following GenBank accessions: maize MET1 (AF063403), rice MET1-1 (OsMET1-1, AF462029), rice MET1-2 (OsMET1-2, TPA BK001405), Arabidopsis MET1(AtMET1, AT5G49160) and MET2 (MET2-type C-5 DNA MTase, AT4G08990), pea MET1 (putative C-5 DNA MTase, AF034419), carrot MET1 (carrot C-5 DNA MTase, AF007807) and MET2 (MET2-type C-5 DNA MTase, AF007808), tobacco MET1 (NtMET1, AB030726), tomato (putative C-5 DNA MTase AJ002140), rat DNMT1 (AB012214), human DNMT1 (AF180682), Xenopus DNMT1(D78638), zebra fish DNMT1 (AF483203), chicken DNMT1 (2112268A), Neurospora DIM2 (AF348971), Ascobolus DNMTase (Z96933), rice MET2a (AC069324), maize MET2a (AF243043) and Haemophilus haemolyticus M.HhaI (XYH1H1)[2]

Knowledge extension

Apart from the main information listed above about function, expression and evolution about OsMET1 gene[1][2], there are also some advanced researches about this gene being conducted in the past few years[3][4][5]. Takaki Yamauchi et al. reported in 2007 that the alternative splicing mechanisms of OsMET1a transcript and OsMET1b transcript differ, which is key to the regulation of active OsMET1 protein generation in different tissues[3]. Daisuke Miki et al. reported in 2008 that de novo DNA methylation can be induced by siRNA targeted to endogenous transcribed sequences which is gene-specific and OsMET1-indepent in rice, which is also the first time to observe transcriptional gene silencing by siRNAs[4]. Takaki Yamauchi et al. reported in 2009 that they successfully realized homologous recombination-promoted knock-in targeting to monitor gene expression by fusing a reporter gene named GUS codingβ-glucuronidase with its promoter in rice, in principle, this method can be applied to modify any endogenous gene which would promote basic and applied plant research[5].

Labs working on this gene

  • Institute of Developmental and Molecular Biology, and Department of Biology, Texas A&M University, College Station, TX, USA
  • National Institute for Basic Biology, Okazaki, Japan
  • Graduate School of Science and Technology, Chiba University, Matsudo, Japan
  • Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Japan
  • Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, Shizuoka, Japan
  • Faculty of Agriculture, Meijo University, Nagoya, Japan
  • Graduate School of Horticulture, Chiba University, Matsudo, Japan
  • Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology (NAIST), Ikoma, Japan
  • Graduate School of Agriculture and Life Sciences, University of Tokyo, Tokyo, Japan
  • Department of Basic Biology, School of Life Science, The Graduate University for Advanced Studies, Okazaki, Japan

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Takaki Yamauchi et al. The MET1b gene encoding a maintenance DNA methyltransferase is indispensable for normal development in rice. Plant Mol Biol(2014) 85:219–232.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 Prapapan Teerawanichpan et al. Characterization of two rice DNA methyltransferase genes and RNAi-mediated reactivation of a silenced transgene in rice callus. Planta(2004) 218:337-349.
  3. 3.0 3.1 Takaki Yamauchi et al. Alternative splicing of the rice OsMET1 genes encoding maintenance DNA methyltransferase. Jounal of Plant Physiology 165(2008) 1774-1782.
  4. 4.0 4.1 Daisuke Miki et al. De novo DNA methylation induced by siRNA targeted to endogenous transcribed sequences is gene-specific and OsMet1-independent in rice. The plant Jounal,(2008)56,539-549.
  5. 5.0 5.1 Takaki Yamauchi et al. Homologous recombination-mediated knock-in targeting of the MET1a gene for a maintenance DNA methyltransferase reproducibly reveals dosage-dependent spatiotemporal gene expression in rice. The plant Jounal(2009) 60, 386-396.

Structured Information