|
|
| (One intermediate revision by one other user not shown) |
| Line 7: |
Line 7: |
| | ===Expression=== | | ===Expression=== |
| | Please input expression information here. | | Please input expression information here. |
| | + | Os07g0422100 whose expression is induced by drought stress, was identified using drought-treated rice plants at the flowering stage, and was found expressing specifically in rice panicle after drought treatment. Os07g0422100 might contain a drought-inducible promoter which makes the gene specifically express in drought stressed rice panicle. When the reporter gene GUS was driven by the promoter of Os07g0422100, the reporter gene can be efficiently induced after drought treatment, therefore affording a method to assess the degree of drought stress. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| Line 20: |
Line 21: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os07g0422100|
| |
| − | Description = AWPM-19-like family protein|
| |
| − | Version = NM_001066020.1 GI:115471772 GeneID:4343047|
| |
| − | Length = 1000 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os07g0422100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
| |
| − | AP = Chromosome 7:14268003..14269002|
| |
| − | CDS = 14268074..14268200,14268296..14268690|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008400:14268003..14269002
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008400:14268003..14269002
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggccggagtcgggaggaacatgctggcgccgctcttggtgctcaacctcatcatgtacctcatcgtcatcggcttcgcgagctggaacctcaaccacttcatcaatggccagaccaactacccaggcgtggcgggcaacggcgcgacgttctacttcctggtgttcgccatcctggccggggtggtgggcgcggcgtccaagctggcgggcgtccaccacgtgcgcgcgtggcgccacgacagcctcgccaccaacgcggcctcctccctcatcgcgtgggccatcaccgcgctcgccttcggcctcgcctgcaaggagatccacatcggcggccaccgcgggtggcgcctccgcgtgctcgaggctttcgtcatcatcctcgccttcacgcagctgctctacgtgctcatgctccacacgggcctcttcggtggcggcgacggcgcctaccgggaccacgactacggcgttggcgccggtgctgccgccggcgagcccaaggggacagcgagggtctga</cdnaseq>|
| |
| − | AA = <aaseq>MAGVGRNMLAPLLVLNLIMYLIVIGFASWNLNHFINGQTNYPGV AGNGATFYFLVFAILAGVVGAASKLAGVHHVRAWRHDSLATNAASSLIAWAITALAFG LACKEIHIGGHRGWRLRVLEAFVIILAFTQLLYVLMLHTGLFGGGDGAYRDHDYGVGA GAAAGEPKGTARV</aaseq>|
| |
| − | DNA = <dnaseqindica>72..198#294..688#tctcgatcgatctcttcttcgtcttctgcgtcgtcgtcgtcgtccagcggtgagctatcagggtagcagccatggccggagtcgggaggaacatgctggcgccgctcttggtgctcaacctcatcatgtacctcatcgtcatcggcttcgcgagctggaacctcaaccacttcatcaatggccagaccaactacccaggtacgacatcgatctgcatatctctgattcttgaaataaaagtgcatgcgacgtactgatatacaatgcgctcgaacacacgtacgtgcgtgcaggcgtggcgggcaacggcgcgacgttctacttcctggtgttcgccatcctggccggggtggtgggcgcggcgtccaagctggcgggcgtccaccacgtgcgcgcgtggcgccacgacagcctcgccaccaacgcggcctcctccctcatcgcgtgggccatcaccgcgctcgccttcggcctcgcctgcaaggagatccacatcggcggccaccgcgggtggcgcctccgcgtgctcgaggctttcgtcatcatcctcgccttcacgcagctgctctacgtgctcatgctccacacgggcctcttcggtggcggcgacggcgcctaccgggaccacgactacggcgttggcgccggtgctgccgccggcgagcccaaggggacagcgagggtctgatcgatgatctccccgacacggggtcacgcaagaataaacgataatacatacttgatggtcattttgtgtgtgtgacagtgtgactgtgaggctctgcctctgtgtgcagcagtgcagtgtaagctctgtgctctcgcctttaattacactactagttgtttagcgttgtgtgttgggtttgtgtagcttgtacatgtgtgtatgtgaccgtacctagtacgtactttgatcgtagtagctaggtgtgcacgtcatggcctgtattttgctcgcatggaagtgccgtcctcaattaattactccttgtcaccg</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066020.1 RefSeq:Os07g0422100]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Os07g0422100 whose expression is induced by drought stress, was identified using drought-treated rice plants at the flowering stage, and was found expressing specifically in rice panicle after drought treatment. Os07g0422100 might contain a drought-inducible promoter which makes the gene specifically express in drought stressed rice panicle. When the reporter gene GUS was driven by the promoter of Os07g0422100, the reporter gene can be efficiently induced after drought treatment, therefore affording a method to assess the degree of drought stress.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information