Difference between revisions of "Os07g0471000"

From RiceWiki
Jump to: navigation, search
(Gene construction)
(Structured Information)
 
(66 intermediate revisions by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
'''OsIRE1''', which is translated by Os07g0471000, is the stress sensors in the endoplasmic reticulum stress response of rice.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Os07g0471000 is a kind of gene which encodes endoplasmic reticulum stress sensor protein OsIRE1 in rice. OsIRE1 is not only a complex transmembrane sensor protein in endoplasmic reticulum, but a transductant in signaling transduction Endoplasmic reticulum stress. OsIRE1 is a kind of kinase, whose N-terminal portion resides are in the ER lumen, and the C-terminal portion resides in the cytosol. The N-terminal portion resides are used to recognize the unfolded or misfolded proteins overloaded in the ER, and the C-terminal portion resides contain a serine/threonine kinase domain and an endo-ribonuclease (RNase) domain [1,2]. When Endoplasmic reticulum stress is triggered by the accumulation of unfolded proteins in the ER lumen, OsIRE1 may sense accumulation of unfolded or misfolded proteins in the ER lumen and cluster, induce autophosphorylation of the kinase domain and consequent activation of the RNase domain [1]. The RNase splices OsbZIP50 which is a kind of mRNA encoding a key transcription factor in rice. The spliced form of OsbZIP50 mediates the expression of genes which encode ER quality control-related factors [3].
+
Os07g0471000 is a kind of gene which encodes endoplasmic reticulum stress sensor protein '''OsIRE1''' in rice. '''OsIRE1''' is not only a complex transmembrane sensor protein in endoplasmic reticulum, but a transductant in signaling transduction Endoplasmic reticulum stress. '''OsIRE1''' is a kind of kinase, whose N-terminal portion resides are in the ER lumen, and the C-terminal portion resides in the cytosol. The N-terminal portion resides are used to recognize the unfolded or misfolded proteins overloaded in the ER, and the C-terminal portion resides contain a serine/threonine kinase domain and an endo-ribonuclease (RNase) domain <ref name="ref1" /><ref name="ref2" />. When Endoplasmic reticulum stress is triggered by the accumulation of unfolded proteins in the ER lumen, '''OsIRE1''' may sense accumulation of unfolded or misfolded proteins in the ER lumen and cluster, induce autophosphorylation of the kinase domain and consequent activation of the RNase domain <ref name="ref1" />. The RNase splices OsbZIP50 which is a kind of mRNA encoding a key transcription factor in rice. The spliced form of OsbZIP50 mediates the expression of genes which encode ER quality control-related factors<ref name="ref3" />.
  
 
===Expression===
 
===Expression===
 
By using the full-length atpI protein sequence (NCBI Reference Sequence: NP_001059606.1), the primers is well-built, which could conduct gene amplication and gene analysis for further research.
 
By using the full-length atpI protein sequence (NCBI Reference Sequence: NP_001059606.1), the primers is well-built, which could conduct gene amplication and gene analysis for further research.
 +
{| class='wikitable' style="text-align:center"
 +
|-
 +
! | Primer
 +
! | Forward primer
 +
! | Reverse primer
 +
|-
 +
| rowspan="1"|Gene amplication
 +
| | 5’- TCCTTCCGGCACAACTTCTCTAAAGCTG-3’
 +
| | 5’- ATGCATCACATACACGGCCGTTG-3’
 +
|-
 +
| rowspan="1"|RT-PCR
 +
| | 5’- TCCTTCCGGCACAACTTCTCTAAAGCTG-3’
 +
| | 5’- ATGCATCACATACACGGCCGTTG-3’
 +
|}
 +
Shimpei Hayashi ''et al.''(2012) generate the transgenic plants of OsbZIP50 (OsbZIP50 KD) or rice '''IRE1''' ('''OsIRE1''') by RNA interference. The OsIRE1 knockdown (KD) lines showed severe defects in growth <ref name="ref4" />.
  
[[File:primer.jpg]]
+
Yuhya Wakasa ''et al.''(2013) generate the transgenic rice plants overexpressing wild-type '''OsIRE1''' (IRE1-OE) and two disrupted-IRE1s deficient in either kinase activity (K519A-OE) or RNase activity (K833A-OE) to investigate effect of overexpression those genes on the endoplasmic reticulum stress response.
 +
Overexpression of wild-type ''OsIRE1'' induced the ER stress response even under non-stress conditions, whereas the phenotypes of K519A-OE and K833A-OE plants are similar to that of ''IRE1-KD''. Phenotypes of wild-type and transgenic rice plants are showed in Figure 1(cited from <ref name="ref5" />).                     
  
Shimpei Hayashi ''et al.''(2012) generate the transgenic plants of OsbZIP50 (OsbZIP50 KD) or rice IRE1 (OsIRE1) by RNA interference. The OsIRE1 knockdown (KD) lines showed severe defects in growth [4].
+
The results suggest that the overexpression of K519A and K833A has an inhibitory influence on the '''OsIRE1'''/OsbZIP50 signaling and ER stress pathway. However, the mechanism of why the overexpression of K519A and K833A has an inhibitory influence on the OsIRE1/OsbZIP50 signaling and ER stress pathway isn’t clear <ref name="ref5" />.
 +
[[File:o.jpg|right|thumb|250px|Figure 1 Pgenotypes of wild-type and transgenic rice. (A) Plant phenotype of the wild-type (wt) and IRE1-OE, IRE1-KD, K519A-OE and K833A-OE rice lines (2 months after germination)(From reference <ref name="ref5" />).'']]
 +
 +
[[File:2.jpg]]
  
Yuhya Wakasa ''et al.''(2013) generate the transgenic rice plants overexpressing wild-type OsIRE1 (IRE1-OE) and two disrupted-IRE1s deficient in either kinase activity (K519A-OE) or RNase activity (K833A-OE) to investigate effect of overexpression those genes on the endoplasmic reticulum stress response.
+
===Gene construction===
Overexpression of wild-type OsIRE1 induced the ER stress response even under non-stress conditions, whereas the phenotypes of K519A-OE and K833A-OE plants are similar to that of IRE1-KD. Phenotypes of wild-type and transgenic rice plants are showed in Figure 1(cited from [5]).                      
+
Basic structure of '''OsIRE1''' is showed in Figure 2<ref name="ref6" />.researchers described the putative domains in OsIre1p predicted from hydropathy plot and database search. SP represents signal peptide. TM represents transmembrane domain. NLS represents nuclear localization signal. Kinase represents Ser/Thr kinase domain. RNase represents ribonuclease-L like domain. Y represents location of putative N-linked glycosylation site.
  
The results suggest that the overexpression of K519A and K833A has an inhibitory influence on the OsIRE1/OsbZIP50 signaling and ER stress pathway. However, the mechanism of why the overexpression of K519A and K833A has an inhibitory influence on the OsIRE1/OsbZIP50 signaling and ER stress pathway isn’t clear [5].
+
===Structure===
 +
The Structure of Ire1 is showed in Figure 3<ref name="ref7" />.
 +
(A) Ribbons representation of the dimeric dualcatalytic region of Ire1 encompassing the protein kinase domain and KEN domain. The kinase N-lobe, C-lobe and the KEN domain are colored green, orange, and blue (protomer 1) and light green, yellow, and light blue (protomer 2), respectively. ADP and coordinating metal ions are shown within the kinase domain catalytic cleft. Two internal regions within the kinase domain and one internal region within the KEN domain not modeled due to disorder are shown as dashed lines.  
 +
(B) A continuous hydrophobic core connects the kinase C-lobe and the KEN domain. Residues originating from the C-lobe and KEN domain are colored in pink and green, respectively. Ribbons diagram color scheme corresponds to that of protomer 2 in (A).
 +
(C) Detailed stereoview of the KEN domain dimer as shown in (A). Disordered regions corresponding to putative RNA specificity determinants are shown as red dashed lines.
 +
(D and E) Dimer interface interactions involving conserved residues in the kinase domain (D) and
 +
the KEN domain (E), respectively, viewed along the two fold axis of rotational symmetry. For clarity, only residues targeted for mutation in this study are shown in ball and stick representation. Residues colored yellow and white originate from promoter 1 and 2, respectively. Ribbons coloring scheme corresponds to that in (A).
  
[[File:over.jpg]]    [[File:Gene.jpg]]
+
[[File:3.jpg]]
  
 +
===Evolution===
 +
Ire1 is an evolutionarily conserved, ER stress sensor present in all eukaryotes with both protein kinase and ribonuclease activities<ref name="ref8" />.
 +
Kenneth et al. (2007) conducted the structure-based sequence alignment of Ire1, especially the sequence of protein kinase domain and KEN (Kinase Extension Nuclease) domain of Ire1. The structure-based sequence alignment of Ire1 is showed in Figure 4<ref name="ref7" />. The subjects include S. cerevisiae (yeast), H. sapiens (human), M. musculus (mouse), R. norvegicus (rat), G. gallus (chicken), X. laevis (frog), D. melanogaster (fruitfly), A. mellifera (honey bee), C. elegans (nematode), A. thaliana (mouse-ear cress), and O. sativa (rice); and RNase L sequences from H. sapiens (human), P. pygmaeus (orangutan), M. musculus (mouse), R. norvegicus (rat), and C. familiarus (dog). Residues invariant or highly conserved specifically in Ire1 are highlighted in green and yellow, respectively, while Residues invariant across the Ire1-RNaseL family of kinase-ribonucleases are colored in blue.
  
===Gene construction===
+
[[File:4.jpg]]
Basic structure of IRE1 of 4 different species is showed in Figure 2. Boldface type highlight the Amino acids identical in at least three sequences. The residues which are essential for kinase or RNase activities of IRE1 are showed in red boxes[4].
 
  
===Evolution===
+
Figure 4  Sequence Conservation in the Dual-Catalytic Core of Ire1
  
 
==Labs working on this gene==
 
==Labs working on this gene==
1. Genetically ModifiedOrganism Research Center, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
+
*Genetically ModifiedOrganism Research Center, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
 
+
*Functional Transgenic Crops Research Unit; Genetically Modified Organism Research Center; National Institute of Agrobiological Sciences; Kannondai, Tsukuba, Ibaraki, Japan
2. Functional Transgenic Crops Research Unit; Genetically Modified Organism Research Center; National Institute of Agrobiological Sciences; Kannondai, Tsukuba, Ibaraki, Japan
+
*State Key Laboratory of Genetic Engineering, Institute of Plant Biology, School of Life Sciences, Fudan University, Shanghai, 200433, China
 +
*Research and Education center of Genetic Information, Nara Institute of Science and technology, Ikoma, 630-0101, Japan
  
 
==References==
 
==References==
1. Hetz, C. & Glimcher, L. H. Fine-tuning of the unfolded protein response: Assembling the IRE1alpha interactome. Mol. Cell 35, 551–561 (2009).
+
<references>
 
+
<ref name="ref1">Hetz, C. & Glimcher, L. H. Fine-tuning of the unfolded protein response: Assembling the IRE1alpha interactome. Mol. Cell 35, 551–561 (2009).</ref>
2. Koizumi, N. et al. Molecular characterization of two Arabidopsis Ire1 homologs, endoplasmic reticulum-located transmembrane protein kinases. Plant Physiol. 127, 949–962 (2001).
+
<ref name="ref2">Koizumi, N. et al. Molecular characterization of two Arabidopsis Ire1 homologs, endoplasmic reticulum-located transmembrane protein kinases. Plant Physiol. 127, 949–962 (2001).</ref>
 
+
<ref name="ref3">Yuhya Wakasa, Shimpei Hayashi, Kenjirou Ozawa & Fumio Takaiwa. Multiple roles of the ER stress sensor IRE1 demonstrated by gene targeting in rice.Scientific Reports. 2 : 944 (2012).</ref>
3. Yuhya Wakasa, Shimpei Hayashi, Kenjirou Ozawa & Fumio Takaiwa. Multiple roles of the ER stress sensor IRE1 demonstrated by gene targeting in rice.Scientific Reports. 2 : 944 (2012).
+
<ref name="ref4">Hayashi, S., Wakasa, Y., Takahashi, H., Kawakatsu, T. & Takaiwa, F. Signal transduction by IRE1-mediated splicing of bZIP50 and other stress sensors in the endoplasmic reticulum stress response of rice. Plant J. 69, 946–956 (2012).</ref>
 +
<ref name="ref5">Yuhya Wakasa, Shimpei Hayashi and Fumio Takaiwa. Effect of overexpression of kinase- or RNasedeficient OsIRE1 on the endoplasmic reticulum stress response in transgenic rice plants. Plant Signaling & Behavior 8:9, e25343; September 2013.</ref>
 +
<ref name="ref6">Yoko Okushima, Nozomu Koizumi, Yube Yamaguchi, Yukio Kimata, Kenji Kohno & Hiroshi Sano. Isolation and characterization of a putative transducer of endoplasmic reticulum stress in Oryza sativa. Plant Cell physiol. 43(5): 532-539 (2002).</ref>
 +
<ref name="ref7">Kenneth P.K. Lee, Madhusudan Dey, Dante Neculai, Chune Cao, Thomas E. Dever, and Frank Sicheri. (2007). Structure of the Dual Enzyme Ire1 Reveals the Basis for Catalysis and Regulation in Nonconventional RNA Splicing. cell.10.057, 89-100.</ref>
 +
<ref name="ref8">Sidrauski, C., and Walter, P. (1997). The transmembrane kinase Ire1p is a site-specific endonuclease that initiates mRNA splicing in the unfolded protein response. Cell 90, 1031–1039.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0471000|
 
Description = Protein kinase-like domain containing protein|
 
Version = NM_001066141.1 GI:115472014 GeneID:4343198|
 
Length = 4856 bp|
 
Definition = Oryza sativa Japonica Group Os07g0471000, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:17530626..17535481|
 
CDS = 17530886..17531175,17531766..17531961,17532046..17533379,17533662..17533834,17533994..17534240<br>,17534336..17534630,17535153..17535299|
 
GCID = <gbrowseImage1>
 
name=NC_008400:17530626..17535481
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:17530626..17535481
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaggtcgctccgccgcgtcctcctccagctcgtgctcctcgccggcgtcgccttccgcggggtccgcttcgacgacgccgccgacgccgccgccgccgcccaggggtcgtcagacctcttcgagctcccttcgccgtccccgactctcgcgctccccggcggcggggatgagggggcctcgacggagatcatcgccgcgccgtggccggggcgccacggcctgttcacgccgccgcggagcacgtcccagccggcgagagcggtggtccagccggccgccgacttcggctcccaactccagttttacgacaatggtacaattcaactagtggaccttctatcaaaattgcctcggtggcagttctccaccggaccccctctttcgaagcatatcactacttcgaaacctgatttgaactatgtcatataccttgatgggtcagaaacatcggaccttatagaagttcataatggcagtggtgtgagacttccctggaaactggaggagtttattgctgagactccatatatacgggattcttttgttacgattggatcaaaggtttcaactacttttgtggtcaatgctgatagcggtgagatcatttacaagcatagcttgccagtggccttgaacgaggtaggtggccccctggttgaggaaattccatccaagttagatgctgctagaagtggtacaagtgctaatatcatagtggttgtgagaactgattattctatcagtgcatcggatcttggggaacatttgttcaactggacaagaacttccttcactgcaaattactatgcgaggtatggccaccaagacatgcttgcccaatcgtcctgtctgcgaggaaatattccatgcattaggactgagggtccaccaattaaactttatttacctgattcaagttcagataatgcaattgtcttgagacctgtgaacgaagtttctgctgtggatgctctggaaccacttctacctccaaagaagttaccacaacctgctggcgagtctaatgtggccttggatagtgctcaaaaccagactgctgacattgccctaggtcattttgtgcctgctgacactgaattgaccaacagtgtcactaaattttcttacagatggctattccccacgtttctcatgttgttgatcatggcttgtctagtgaaattggccgatgcaagcaaatattgcaggcaatttgtgattcgatttttgaagccatttatgcgtgatgagaaattgatggacccaagaggcaaatcagagggaacatcaaaaagaaggaaggcgcggaagaaagatggacttatcaatagcactcagatcttttcagcatctgataaagaggggaatggaactggtggatcaactgaggcacaaagtaataaagcacatgattcaacaaatgtggaactccctaatggcctcaatgggcgtcagattggtaagctttgtgtttacagtaaagaaattggtaaagggagcaatggtacagttgtctttgaaggctcctatggtggtcgggaagttgctgtgaaacgtctgctgcgctctcacaatgatatagcctcgaaagagattgagaatctgattgcatctgatcaggatcctaatattgttcgaatgtatggttttgagcaggacaatgattttgtttatatctcccttgagaggtgtcgctgcagcttggctgatctaatccaactgcactcggtaccaccattttcaaatactaagggaacagacattgaactttggaggcaggatggacttccttcggcacaacttctaaagctgatgagagatgttgttgctggtattgtgcatttgcatagtttgggaattatacatcgtgatttgaagcctcagaatgttttgataagcaaggaaggacctctcagagcaaaactttcagatatgggtatcagtaagcgtttgcaggaggatatgacttctgttagtcatcatggcactggatttggaagctctggttggcaagcacctgaacagcttcgtcatggtcgtcagactcgagccatagatttatttagtttgggctgccttatattctattgcattactaaaggcaagcatccgtttggtgagtactatgaacgggacatgaaaatcataaacaatcaatttgatctcttcatagtggatcacataccagaagcagtgcatcttatttctcaactgttagatccagatccagagaagagaccaacggccgtgtatgtgatgcatcatcctttcttttggagccctgagttgtgcctttcatttctacgagataccagtgacagaattgagaaaaccagtgaaactgatctcatagatgctttggaaggcataaatgttgaagcatttggtaaaaattggggagagaaattagatgctgccctgcttgcagacatgggacgttatagaaaatatagttttgagtccactcgtgaccttctaagattgatcagaaacaaatcaggacattacagagaattttcagatgatctcaaggagctacttgggtcgctgccggagggatttgttcagtatttctcaagccgattcccaaagctgctaattaaagtctacgaggtcatgtccgagcattgcaaggacgaagaagctttcagcaaatatttccttggaagctcggcgtag</cdnaseq>|
 
AA = <aaseq>MRSLRRVLLQLVLLAGVAFRGVRFDDAADAAAAAQGSSDLFELP                    SPSPTLALPGGGDEGASTEIIAAPWPGRHGLFTPPRSTSQPARAVVQPAADFGSQLQF                    YDNGTIQLVDLLSKLPRWQFSTGPPLSKHITTSKPDLNYVIYLDGSETSDLIEVHNGS                    GVRLPWKLEEFIAETPYIRDSFVTIGSKVSTTFVVNADSGEIIYKHSLPVALNEVGGP                    LVEEIPSKLDAARSGTSANIIVVVRTDYSISASDLGEHLFNWTRTSFTANYYARYGHQ                    DMLAQSSCLRGNIPCIRTEGPPIKLYLPDSSSDNAIVLRPVNEVSAVDALEPLLPPKK                    LPQPAGESNVALDSAQNQTADIALGHFVPADTELTNSVTKFSYRWLFPTFLMLLIMAC                    LVKLADASKYCRQFVIRFLKPFMRDEKLMDPRGKSEGTSKRRKARKKDGLINSTQIFS                    ASDKEGNGTGGSTEAQSNKAHDSTNVELPNGLNGRQIGKLCVYSKEIGKGSNGTVVFE                    GSYGGREVAVKRLLRSHNDIASKEIENLIASDQDPNIVRMYGFEQDNDFVYISLERCR                    CSLADLIQLHSVPPFSNTKGTDIELWRQDGLPSAQLLKLMRDVVAGIVHLHSLGIIHR                    DLKPQNVLISKEGPLRAKLSDMGISKRLQEDMTSVSHHGTGFGSSGWQAPEQLRHGRQ                    TRAIDLFSLGCLIFYCITKGKHPFGEYYERDMKIINNQFDLFIVDHIPEAVHLISQLL                    DPDPEKRPTAVYVMHHPFFWSPELCLSFLRDTSDRIEKTSETDLIDALEGINVEAFGK                    NWGEKLDAALLADMGRYRKYSFESTRDLLRLIRNKSGHYREFSDDLKELLGSLPEGFV                    QYFSSRFPKLLIKVYEVMSEHCKDEEAFSKYFLGSSA</aaseq>|
 
DNA = <dnaseqindica>261..550#1141..1336#1421..2754#3037..3209#3369..3615#3711..4005#4528..4674#ggctgtcacgcacgcacgcgtgggcgcgtagcaaagcaaagcagcgaatccggcttcactagtcttcttcccccccgccgccgcatcgatcccccttcccctcgtcttccttccctttcccccaatcagattgcttccagaagcctccttccccgcgaagcaaccaaccccttccggatcccgactccatccaaacccccatcccctcccctctcccctacgctcgaaaccctagggagatccatccacatgccgccccgatgaggtcgctccgccgcgtcctcctccagctcgtgctcctcgccggcgtcgccttccgcggggtccgcttcgacgacgccgccgacgccgccgccgccgcccaggggtcgtcagacctcttcgagctcccttcgccgtccccgactctcgcgctccccggcggcggggatgagggggcctcgacggagatcatcgccgcgccgtggccggggcgccacggcctgttcacgccgccgcggagcacgtcccagccggcgagagcggtggtccagccggccgccgacttcgggtgagcttcttggtccccctccctccgtcttcttccagttgcgatgctgttcaggaggaggctatggagtctataggaggtggatcgattggcttgtgcagcgggacagggtggggggggggggggctttgcctcctgttcttatccttggcttttggaggagcgaaatggattcccatcccgccaagtgttaaagagggtttcttgtagttagggaggcttgctatgttcctttgtcactttcttgctttcgtgctgcaatggagtggggaaatgcggggaaaagagagctctctagctgcttaggtcatgcatgatccatggttggaacagcatcttcttgctgctttggtagttctcactagcattagtaatgacatgactttgcttgattgcattgcacttcaattttagtattagttacgaattaatttatggaaatgagcagcttttgcacttactattcctagtataagaggtgctacttatgattcaaattgagctgtttggttcatttcttatgtgtgtactttccattttgtcccgccatttgaaattgcaacttatttgcttgtttttattgtgaacagctcccaactccagttttacgacaatggtacaattcaactagtggaccttctatcaaaattgcctcggtggcagttctccaccggaccccctctttcgaagcatatcactacttcgaaacctgatttgaactatgtcatataccttgatgggtcagaaacatcggaccttatagaagttcataatggcagtggtgtggtatgctttgcacaattgcgttagttctcaacatcctgtctagttttgctttgtttctcacctatcactggcttattcctgtagagacttccctggaaactggaggagtttattgctgagactccatatatacgggattcttttgttacgattggatcaaaggtttcaactacttttgtggtcaatgctgatagcggtgagatcatttacaagcatagcttgccagtggccttgaacgaggtaggtggccccctggttgaggaaattccatccaagttagatgctgctagaagtggtacaagtgctaatatcatagtggttgtgagaactgattattctatcagtgcatcggatcttggggaacatttgttcaactggacaagaacttccttcactgcaaattactatgcgaggtatggccaccaagacatgcttgcccaatcgtcctgtctgcgaggaaatattccatgcattaggactgagggtccaccaattaaactttatttacctgattcaagttcagataatgcaattgtcttgagacctgtgaacgaagtttctgctgtggatgctctggaaccacttctacctccaaagaagttaccacaacctgctggcgagtctaatgtggccttggatagtgctcaaaaccagactgctgacattgccctaggtcattttgtgcctgctgacactgaattgaccaacagtgtcactaaattttcttacagatggctattccccacgtttctcatgttgttgatcatggcttgtctagtgaaattggccgatgcaagcaaatattgcaggcaatttgtgattcgatttttgaagccatttatgcgtgatgagaaattgatggacccaagaggcaaatcagagggaacatcaaaaagaaggaaggcgcggaagaaagatggacttatcaatagcactcagatcttttcagcatctgataaagaggggaatggaactggtggatcaactgaggcacaaagtaataaagcacatgattcaacaaatgtggaactccctaatggcctcaatgggcgtcagattggtaagctttgtgtttacagtaaagaaattggtaaagggagcaatggtacagttgtctttgaaggctcctatggtggtcgggaagttgctgtgaaacgtctgctgcgctctcacaatgatatagcctcgaaagagattgagaatctgattgcatctgatcaggatcctaatattgttcgaatgtatggttttgagcaggacaatgattttgtttatatctcccttgagaggtgtcgctgcagcttggctgatctaatccaactgcactcggtaccaccattttcaaatactaagggaacagacattgaactttggaggcaggatggacttccttcggcacaacttctaaagctgatgaggtatgtgacaactggtcactggtgccctttcatgttgcacaccatgtttatcagtatatgcatgtgttgtttactttgagattaattgactaaggtcacgcttatgcatagcttaacttgatgcccttttgctaagaacactttgccaacaaccaacatccaccatttgctattacaaagttccttaatggctgatattatttgcctgcctattcttggtattgttgctagcgtgtccaccagaccaccactgatgttgcccttgtgaattttcatgtgcagagatgttgttgctggtattgtgcatttgcatagtttgggaattatacatcgtgatttgaagcctcagaatgttttgataagcaaggaaggacctctcagagcaaaactttcagatatgggtatcagtaagcgtttgcaggaggatatgacttctgttagtcatcatggcactggtaaggttcaaagttgcttgcgaatatgcaatatgagaaattactttctgtatcttttttatggtcaaggtcaactttcttaagtgcattttttagtcattgcgatgctctctctctctctctctaactagccatttcatccctgtcaacttactgcaggatttggaagctctggttggcaagcacctgaacagcttcgtcatggtcgtcagactcgagccatagatttatttagtttgggctgccttatattctattgcattactaaaggcaagcatccgtttggtgagtactatgaacgggacatgaaaatcataaacaatcaatttgatctcttcatagtggatcacataccagaagcagtgcatcttatttctcaactgttagatccagatccagagaagaggtaagaataatttggtattttgacatcgttaatgccctgaacatttaaaaaggcttcctgattttctgaatgcatttttttattaatgttaacagaccaacggccgtgtatgtgatgcatcatcctttcttttggagccctgagttgtgcctttcatttctacgagataccagtgacagaattgagaaaaccagtgaaactgatctcatagatgctttggaaggcataaatgttgaagcatttggtaaaaattggggagagaaattagatgctgccctgcttgcagacatgggacgttatagaaaatatagttttgagtccactcgtgaccttctaagattgatcagaaacaaatcaggacattacagagaattttcagatgatctcaaggtctgttgctgcatttcttgttttgtttgctttgttttagttttcctgcatacagctaaactatgggtcaaacaagaggtggtgctgtagtatgcatgaatgctgttgtgtgttcaatggatgttcatattagttgctgtgcatgaatgtagtatataggaaaagtagttagttgcagtcatgaatgttatattagttgcttctgtattatcttagatagtttcttagtttacttcttttatgtaaggttcaactaaactatgtagtgtgctagtttgtgatgattttgattctacagtcttatcttcctcacaagggtgggcactactgctgacctcctcctaggagttaggatatatctctgccttttcggttttctggagaatattaaaagtttgagatactattttatacattttcagttttctgaagaatattatcaagtttgagatactacttacagattgtgaccatgcaatcatcatcccagacgctaacatattcatgttaataaaattccaggagctacttgggtcgctgccggagggatttgttcagtatttctcaagccgattcccaaagctgctaattaaagtctacgaggtcatgtccgagcattgcaaggacgaagaagctttcagcaaatatttccttggaagctcggcgtagctgtaacctgcaggaggggtgaaggccctgccctgcctagtgtgtacactaacactcttctagcaaaaatgtatgtacatgtgatttgtaccatatatcatagggtaaagaaagttcagcctgtacattgtattccacagaattgtgtattacttatagtaaatcaaatcttttacctgact</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066141.1 RefSeq:Os07g0471000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:39, 12 June 2015

OsIRE1, which is translated by Os07g0471000, is the stress sensors in the endoplasmic reticulum stress response of rice.

Annotated Information

Function

Os07g0471000 is a kind of gene which encodes endoplasmic reticulum stress sensor protein OsIRE1 in rice. OsIRE1 is not only a complex transmembrane sensor protein in endoplasmic reticulum, but a transductant in signaling transduction Endoplasmic reticulum stress. OsIRE1 is a kind of kinase, whose N-terminal portion resides are in the ER lumen, and the C-terminal portion resides in the cytosol. The N-terminal portion resides are used to recognize the unfolded or misfolded proteins overloaded in the ER, and the C-terminal portion resides contain a serine/threonine kinase domain and an endo-ribonuclease (RNase) domain [1][2]. When Endoplasmic reticulum stress is triggered by the accumulation of unfolded proteins in the ER lumen, OsIRE1 may sense accumulation of unfolded or misfolded proteins in the ER lumen and cluster, induce autophosphorylation of the kinase domain and consequent activation of the RNase domain [1]. The RNase splices OsbZIP50 which is a kind of mRNA encoding a key transcription factor in rice. The spliced form of OsbZIP50 mediates the expression of genes which encode ER quality control-related factors[3].

Expression

By using the full-length atpI protein sequence (NCBI Reference Sequence: NP_001059606.1), the primers is well-built, which could conduct gene amplication and gene analysis for further research.

Primer Forward primer Reverse primer
Gene amplication 5’- TCCTTCCGGCACAACTTCTCTAAAGCTG-3’ 5’- ATGCATCACATACACGGCCGTTG-3’
RT-PCR 5’- TCCTTCCGGCACAACTTCTCTAAAGCTG-3’ 5’- ATGCATCACATACACGGCCGTTG-3’

Shimpei Hayashi et al.(2012) generate the transgenic plants of OsbZIP50 (OsbZIP50 KD) or rice IRE1 (OsIRE1) by RNA interference. The OsIRE1 knockdown (KD) lines showed severe defects in growth [4].

Yuhya Wakasa et al.(2013) generate the transgenic rice plants overexpressing wild-type OsIRE1 (IRE1-OE) and two disrupted-IRE1s deficient in either kinase activity (K519A-OE) or RNase activity (K833A-OE) to investigate effect of overexpression those genes on the endoplasmic reticulum stress response. Overexpression of wild-type OsIRE1 induced the ER stress response even under non-stress conditions, whereas the phenotypes of K519A-OE and K833A-OE plants are similar to that of IRE1-KD. Phenotypes of wild-type and transgenic rice plants are showed in Figure 1(cited from [5]).

The results suggest that the overexpression of K519A and K833A has an inhibitory influence on the OsIRE1/OsbZIP50 signaling and ER stress pathway. However, the mechanism of why the overexpression of K519A and K833A has an inhibitory influence on the OsIRE1/OsbZIP50 signaling and ER stress pathway isn’t clear [5].

Figure 1 Pgenotypes of wild-type and transgenic rice. (A) Plant phenotype of the wild-type (wt) and IRE1-OE, IRE1-KD, K519A-OE and K833A-OE rice lines (2 months after germination)(From reference [5]).

2.jpg

Gene construction

Basic structure of OsIRE1 is showed in Figure 2[6].researchers described the putative domains in OsIre1p predicted from hydropathy plot and database search. SP represents signal peptide. TM represents transmembrane domain. NLS represents nuclear localization signal. Kinase represents Ser/Thr kinase domain. RNase represents ribonuclease-L like domain. Y represents location of putative N-linked glycosylation site.

Structure

The Structure of Ire1 is showed in Figure 3[7]. (A) Ribbons representation of the dimeric dualcatalytic region of Ire1 encompassing the protein kinase domain and KEN domain. The kinase N-lobe, C-lobe and the KEN domain are colored green, orange, and blue (protomer 1) and light green, yellow, and light blue (protomer 2), respectively. ADP and coordinating metal ions are shown within the kinase domain catalytic cleft. Two internal regions within the kinase domain and one internal region within the KEN domain not modeled due to disorder are shown as dashed lines. (B) A continuous hydrophobic core connects the kinase C-lobe and the KEN domain. Residues originating from the C-lobe and KEN domain are colored in pink and green, respectively. Ribbons diagram color scheme corresponds to that of protomer 2 in (A). (C) Detailed stereoview of the KEN domain dimer as shown in (A). Disordered regions corresponding to putative RNA specificity determinants are shown as red dashed lines. (D and E) Dimer interface interactions involving conserved residues in the kinase domain (D) and the KEN domain (E), respectively, viewed along the two fold axis of rotational symmetry. For clarity, only residues targeted for mutation in this study are shown in ball and stick representation. Residues colored yellow and white originate from promoter 1 and 2, respectively. Ribbons coloring scheme corresponds to that in (A).

3.jpg

Evolution

Ire1 is an evolutionarily conserved, ER stress sensor present in all eukaryotes with both protein kinase and ribonuclease activities[8]. Kenneth et al. (2007) conducted the structure-based sequence alignment of Ire1, especially the sequence of protein kinase domain and KEN (Kinase Extension Nuclease) domain of Ire1. The structure-based sequence alignment of Ire1 is showed in Figure 4[7]. The subjects include S. cerevisiae (yeast), H. sapiens (human), M. musculus (mouse), R. norvegicus (rat), G. gallus (chicken), X. laevis (frog), D. melanogaster (fruitfly), A. mellifera (honey bee), C. elegans (nematode), A. thaliana (mouse-ear cress), and O. sativa (rice); and RNase L sequences from H. sapiens (human), P. pygmaeus (orangutan), M. musculus (mouse), R. norvegicus (rat), and C. familiarus (dog). Residues invariant or highly conserved specifically in Ire1 are highlighted in green and yellow, respectively, while Residues invariant across the Ire1-RNaseL family of kinase-ribonucleases are colored in blue.

4.jpg

Figure 4 Sequence Conservation in the Dual-Catalytic Core of Ire1

Labs working on this gene

  • Genetically ModifiedOrganism Research Center, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
  • Functional Transgenic Crops Research Unit; Genetically Modified Organism Research Center; National Institute of Agrobiological Sciences; Kannondai, Tsukuba, Ibaraki, Japan
  • State Key Laboratory of Genetic Engineering, Institute of Plant Biology, School of Life Sciences, Fudan University, Shanghai, 200433, China
  • Research and Education center of Genetic Information, Nara Institute of Science and technology, Ikoma, 630-0101, Japan

References

  1. 1.0 1.1 Hetz, C. & Glimcher, L. H. Fine-tuning of the unfolded protein response: Assembling the IRE1alpha interactome. Mol. Cell 35, 551–561 (2009).
  2. Koizumi, N. et al. Molecular characterization of two Arabidopsis Ire1 homologs, endoplasmic reticulum-located transmembrane protein kinases. Plant Physiol. 127, 949–962 (2001).
  3. Yuhya Wakasa, Shimpei Hayashi, Kenjirou Ozawa & Fumio Takaiwa. Multiple roles of the ER stress sensor IRE1 demonstrated by gene targeting in rice.Scientific Reports. 2 : 944 (2012).
  4. Hayashi, S., Wakasa, Y., Takahashi, H., Kawakatsu, T. & Takaiwa, F. Signal transduction by IRE1-mediated splicing of bZIP50 and other stress sensors in the endoplasmic reticulum stress response of rice. Plant J. 69, 946–956 (2012).
  5. 5.0 5.1 5.2 Yuhya Wakasa, Shimpei Hayashi and Fumio Takaiwa. Effect of overexpression of kinase- or RNasedeficient OsIRE1 on the endoplasmic reticulum stress response in transgenic rice plants. Plant Signaling & Behavior 8:9, e25343; September 2013.
  6. Yoko Okushima, Nozomu Koizumi, Yube Yamaguchi, Yukio Kimata, Kenji Kohno & Hiroshi Sano. Isolation and characterization of a putative transducer of endoplasmic reticulum stress in Oryza sativa. Plant Cell physiol. 43(5): 532-539 (2002).
  7. 7.0 7.1 Kenneth P.K. Lee, Madhusudan Dey, Dante Neculai, Chune Cao, Thomas E. Dever, and Frank Sicheri. (2007). Structure of the Dual Enzyme Ire1 Reveals the Basis for Catalysis and Regulation in Nonconventional RNA Splicing. cell.10.057, 89-100.
  8. Sidrauski, C., and Walter, P. (1997). The transmembrane kinase Ire1p is a site-specific endonuclease that initiates mRNA splicing in the unfolded protein response. Cell 90, 1031–1039.

Structured Information