Difference between revisions of "Os07g0568700"

From RiceWiki
Jump to: navigation, search
(References)
(Structured Information)
 
(13 intermediate revisions by one other user not shown)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
 +
[[File:Figure 4. Expression pattern of OsFOR1.png|right|thumb|120px|''Expression pattern of OsFOR1.'']]
 +
 
The OsFOR1 (Oryza sativa floral organ regulator 1) gene encodes a protein that contains a leucine-rich repeat (LRR) domain. This domain comprises 10 tandem repeats of a canonical 24-amino acid LRR sequence. The structure and the number of LRRs for OsFOR1 are similar to those of polygalacturonase-inhibiting proteins (PGIPs) from various other plant species.OsFOR1 is highly expressed in the calli and immature and mature panicles, while detectable at only low levels in seedling roots and mature stems. In situ hybridization experiments showed the transcripts of OsFOR1 are present in young spikelet primordia and in almost all of the young floral organs.
 
The OsFOR1 (Oryza sativa floral organ regulator 1) gene encodes a protein that contains a leucine-rich repeat (LRR) domain. This domain comprises 10 tandem repeats of a canonical 24-amino acid LRR sequence. The structure and the number of LRRs for OsFOR1 are similar to those of polygalacturonase-inhibiting proteins (PGIPs) from various other plant species.OsFOR1 is highly expressed in the calli and immature and mature panicles, while detectable at only low levels in seedling roots and mature stems. In situ hybridization experiments showed the transcripts of OsFOR1 are present in young spikelet primordia and in almost all of the young floral organs.
 +
 +
[[File:Figure 6. Phenotypes of OsFOR1antisense transgenic spikelets.png|right|thumb|120px|''Phenotypes of OsFOR1antisense transgenic spikelets.'']]
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
OsFOR1 protein shows high sequence similiarity with the LRR domain proteins of the PGIP family from various dicotyledonous species including ''Actinidia deliciosa, Malus× domestica, Citrus'' sp. cv. Sainumphung, ''Antirrhinum majus, Arabidopsis thaliana,''and ''Daucus carota''
  
[[File:Figure 1. A. Schematic representation of OsFOR1.jpg|right|thumb|500px|''Schematic representation of OsFOR1.'']]
+
[[File:Figure 1. A. Schematic representation of OsFOR1.jpg|right|thumb|120px|''Schematic representation of OsFOR1.'']]
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Y.H. Moon for providing the cDNA library of rice panicles
 +
*J. Nam and S. Kim for DNA sequencing
 +
*S.K. Kim and S.I. Kim for maintaining the transgenic rice plants
 +
*Priscilla Licht for critical reading of the manuscript
 +
*Monsanto for providing the OsFOR1 genomic DNA sequences
 +
*NRL program,Korea Instituteof Science and Technology Evaluation and Planning,the Crop Functional Genomic Center, the 21 Century Frontier Program (CG1111 and CG1114), the Biogreen 21 program,Rural Development Administration,the BK21 program, Ministry of Education,POSCO provide the grants.
  
 
==References==
 
==References==
1. Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An
+
*Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An;The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice;Plant Molecular Biology, 2003, 53(3): 357-372.
  The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice
+
*Becraft, P.W. Receptor kinase signaling in plant development.Annu. Rev. Cell. Dev. Biol.2002.18: 163–192.
  Plant Molecular Biology, 2003, 53(3): 357-372
 
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0568700|
 
Description = Polygalacturonase inhibitor 1 precursor (Polygalacturonase-inhibiting protein) (Floral organ regulator 1)|
 
Version = NM_001066567.1 GI:115472866 GeneID:4343645|
 
Length = 1449 bp|
 
Definition = Oryza sativa Japonica Group Os07g0568700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:23534415..23535863|
 
CDS = 23534806..23535804|
 
GCID = <gbrowseImage1>
 
name=NC_008400:23534415..23535863
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:23534415..23535863
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgtccaccgcctctttcatgctcgccgtcttgctggcggtggccgtcgcggcggcgccggcgagggcggtgcgatgcccgccgagcgacaagcaggcgctgatgagagtgaagcagtcgctgggaaacccggcgacgctgtcgacgtggtccctggcgtcggcggactgctgcgagtgggaccacgtccggtgcgacgaggccgggcgcgtgaacaacgtcttcatcgacggcgccaacgacgtccgcggccagatcccgtccgccgtggcggggctgacggcgctcatgtcgctgtcgctgttccgcctcccgggcctctccggccccatcccggcgtgcctcaccgcgctctccaacctccagttcctcaccatctcccacaccaacgtctccggcgtcatcccggactcgctcgcgcggatccgcagcctcgactccgtcgacctctcccacaacagcctgaccggccccatcccgaactccttctccgacctcccgaacctccggtcgcttgacctccgcagcaacaagctgacgggttgcatcccggcggggctcgtgcaggggcagttcaggtcgctgatcctctcctacaaccagctcaccggcccgatcccgcgcgacgacgcgcaggacgagatcaacaccgtcgacctctcgcacaaccgcctcaccggcgacgcctccttcctcttcgccgccggccggcccatcggcaaggtggacctctcgtggaacgacctcgacttcgacctcagcaagctcgtcttcccgccggagctcacctacctggacctcagccacaaccgcatcaggggcaccgtgccacgctccctcgccgcgctctccacgctgcagacgctggacctcagctacaaccgcctctgcggcccgctcccgaggctgcacggcgtcatccgccacggctgcaagccgtacgagcacaaccagtgcgccggcggcgccccgctcggcgggtgccaccaatcgtga</cdnaseq>|
 
AA = <aaseq>MASTASFMLAVLLAVAVAAAPARAVRCPPSDKQALMRVKQSLGN                    PATLSTWSLASADCCEWDHVRCDEAGRVNNVFIDGANDVRGQIPSAVAGLTALMSLSL                    FRLPGLSGPIPACLTALSNLQFLTISHTNVSGVIPDSLARIRSLDSVDLSHNSLTGPI                    PNSFSDLPNLRSLDLRSNKLTGCIPAGLVQGQFRSLILSYNQLTGPIPRDDAQDEINT                    VDLSHNRLTGDASFLFAAGRPIGKVDLSWNDLDFDLSKLVFPPELTYLDLSHNRIRGT                    VPRSLAALSTLQTLDLSYNRLCGPLPRLHGVIRHGCKPYEHNQCAGGAPLGGCHQS</aaseq>|
 
DNA = <dnaseqindica>60..1058#actcactcacacacactcaagccagctccagccacacgagcctagttcaggtagatacaatggcgtccaccgcctctttcatgctcgccgtcttgctggcggtggccgtcgcggcggcgccggcgagggcggtgcgatgcccgccgagcgacaagcaggcgctgatgagagtgaagcagtcgctgggaaacccggcgacgctgtcgacgtggtccctggcgtcggcggactgctgcgagtgggaccacgtccggtgcgacgaggccgggcgcgtgaacaacgtcttcatcgacggcgccaacgacgtccgcggccagatcccgtccgccgtggcggggctgacggcgctcatgtcgctgtcgctgttccgcctcccgggcctctccggccccatcccggcgtgcctcaccgcgctctccaacctccagttcctcaccatctcccacaccaacgtctccggcgtcatcccggactcgctcgcgcggatccgcagcctcgactccgtcgacctctcccacaacagcctgaccggccccatcccgaactccttctccgacctcccgaacctccggtcgcttgacctccgcagcaacaagctgacgggttgcatcccggcggggctcgtgcaggggcagttcaggtcgctgatcctctcctacaaccagctcaccggcccgatcccgcgcgacgacgcgcaggacgagatcaacaccgtcgacctctcgcacaaccgcctcaccggcgacgcctccttcctcttcgccgccggccggcccatcggcaaggtggacctctcgtggaacgacctcgacttcgacctcagcaagctcgtcttcccgccggagctcacctacctggacctcagccacaaccgcatcaggggcaccgtgccacgctccctcgccgcgctctccacgctgcagacgctggacctcagctacaaccgcctctgcggcccgctcccgaggctgcacggcgtcatccgccacggctgcaagccgtacgagcacaaccagtgcgccggcggcgccccgctcggcgggtgccaccaatcgtgagcatccatccatccatcaccgccggcgagctgatgctgccacgtaaggtggagcccggggtgcgtaacggtatacgtgtttggtgttttttcgcgtacggggacgtggccgtgtagtacacggtacgacgggtgcagccgtgcagggtactgggcgggtttacgttagtacaaattgtaaccaaggtagagtgcctgcacgcgtgcgtggtcgactctccttcagattgtacgaaacgagggagccgtgtgtacgtgtgcgtacgtgtaccgtgtatggagtacgatgatgatgatgatgcaagtgtgtgtattgtgaatgtacgttatggatcgccctaatgtatcatcgaaatgataagtgtttgatataatttgcctttcgttcttgt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066567.1 RefSeq:Os07g0568700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:46, 12 June 2015

The OsFOR1(Oryza sativa floral organ regulator 1) gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice.

Annotated Information

Function

OsFOR1 plays a role in the formation and/or maintenance of floral organ primordia.the OsFOR1 recombinant protein, when fused to maltose-binding protein (MBP), shows PGIP activity against the Aspergillus niger polygalacturonase. Antisense expression of OsFOR1 resulted in an increase in the numbers of floral organs, including the stamen, carpel, palea/lemma, stigma, and lodicule.

Expression

Expression pattern of OsFOR1.

The OsFOR1 (Oryza sativa floral organ regulator 1) gene encodes a protein that contains a leucine-rich repeat (LRR) domain. This domain comprises 10 tandem repeats of a canonical 24-amino acid LRR sequence. The structure and the number of LRRs for OsFOR1 are similar to those of polygalacturonase-inhibiting proteins (PGIPs) from various other plant species.OsFOR1 is highly expressed in the calli and immature and mature panicles, while detectable at only low levels in seedling roots and mature stems. In situ hybridization experiments showed the transcripts of OsFOR1 are present in young spikelet primordia and in almost all of the young floral organs.

Phenotypes of OsFOR1antisense transgenic spikelets.

Evolution

OsFOR1 protein shows high sequence similiarity with the LRR domain proteins of the PGIP family from various dicotyledonous species including Actinidia deliciosa, Malus× domestica, Citrus sp. cv. Sainumphung, Antirrhinum majus, Arabidopsis thaliana,and Daucus carota

Schematic representation of OsFOR1.

Labs working on this gene

  • Y.H. Moon for providing the cDNA library of rice panicles
  • J. Nam and S. Kim for DNA sequencing
  • S.K. Kim and S.I. Kim for maintaining the transgenic rice plants
  • Priscilla Licht for critical reading of the manuscript
  • Monsanto for providing the OsFOR1 genomic DNA sequences
  • NRL program,Korea Instituteof Science and Technology Evaluation and Planning,the Crop Functional Genomic Center, the 21 Century Frontier Program (CG1111 and CG1114), the Biogreen 21 program,Rural Development Administration,the BK21 program, Ministry of Education,POSCO provide the grants.

References

  • Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An;The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice;Plant Molecular Biology, 2003, 53(3): 357-372.
  • Becraft, P.W. Receptor kinase signaling in plant development.Annu. Rev. Cell. Dev. Biol.2002.18: 163–192.

Structured Information