|
|
| (5 intermediate revisions by one other user not shown) |
| Line 18: |
Line 18: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | 1.Y.H. Moon for providing the cDNA library of rice panicles;
| + | *Y.H. Moon for providing the cDNA library of rice panicles |
| − | 2.J. Nam and S. Kim for DNA sequencing;
| + | *J. Nam and S. Kim for DNA sequencing |
| − | 3.S.K. Kim and S.I. Kim for maintaining the transgenic rice plants;
| + | *S.K. Kim and S.I. Kim for maintaining the transgenic rice plants |
| − | 3.Priscilla Licht for critical reading of the manuscript;
| + | *Priscilla Licht for critical reading of the manuscript |
| − | 4.Monsanto for providing the OsFOR1 genomic DNA sequences;
| + | *Monsanto for providing the OsFOR1 genomic DNA sequences |
| − | 5.NRL program,Korea Instituteof Science and
| + | *NRL program,Korea Instituteof Science and Technology Evaluation and Planning,the Crop Functional Genomic Center, the 21 Century Frontier Program (CG1111 and CG1114), the Biogreen 21 program,Rural Development Administration,the BK21 program, Ministry of Education,POSCO provide the grants. |
| − | Technology Evaluation and Planning,the Crop Functional Genomic Center, the 21 Century Frontier Program (CG1111 and CG1114), the Biogreen 21 program,Rural Development Administration,the BK21 program, Ministry of Education,POSCO provide the grants. | |
| | | | |
| | ==References== | | ==References== |
| − | 1. Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An;The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice;Plant Molecular Biology, 2003, 53(3): 357-372
| + | *Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An;The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice;Plant Molecular Biology, 2003, 53(3): 357-372. |
| | + | *Becraft, P.W. Receptor kinase signaling in plant development.Annu. Rev. Cell. Dev. Biol.2002.18: 163–192. |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os07g0568700|
| |
| − | Description = Polygalacturonase inhibitor 1 precursor (Polygalacturonase-inhibiting protein) (Floral organ regulator 1)|
| |
| − | Version = NM_001066567.1 GI:115472866 GeneID:4343645|
| |
| − | Length = 1449 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os07g0568700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
| |
| − | AP = Chromosome 7:23534415..23535863|
| |
| − | CDS = 23534806..23535804|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008400:23534415..23535863
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008400:23534415..23535863
| |
| − | source=RiceChromosome07
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcgtccaccgcctctttcatgctcgccgtcttgctggcggtggccgtcgcggcggcgccggcgagggcggtgcgatgcccgccgagcgacaagcaggcgctgatgagagtgaagcagtcgctgggaaacccggcgacgctgtcgacgtggtccctggcgtcggcggactgctgcgagtgggaccacgtccggtgcgacgaggccgggcgcgtgaacaacgtcttcatcgacggcgccaacgacgtccgcggccagatcccgtccgccgtggcggggctgacggcgctcatgtcgctgtcgctgttccgcctcccgggcctctccggccccatcccggcgtgcctcaccgcgctctccaacctccagttcctcaccatctcccacaccaacgtctccggcgtcatcccggactcgctcgcgcggatccgcagcctcgactccgtcgacctctcccacaacagcctgaccggccccatcccgaactccttctccgacctcccgaacctccggtcgcttgacctccgcagcaacaagctgacgggttgcatcccggcggggctcgtgcaggggcagttcaggtcgctgatcctctcctacaaccagctcaccggcccgatcccgcgcgacgacgcgcaggacgagatcaacaccgtcgacctctcgcacaaccgcctcaccggcgacgcctccttcctcttcgccgccggccggcccatcggcaaggtggacctctcgtggaacgacctcgacttcgacctcagcaagctcgtcttcccgccggagctcacctacctggacctcagccacaaccgcatcaggggcaccgtgccacgctccctcgccgcgctctccacgctgcagacgctggacctcagctacaaccgcctctgcggcccgctcccgaggctgcacggcgtcatccgccacggctgcaagccgtacgagcacaaccagtgcgccggcggcgccccgctcggcgggtgccaccaatcgtga</cdnaseq>|
| |
| − | AA = <aaseq>MASTASFMLAVLLAVAVAAAPARAVRCPPSDKQALMRVKQSLGN PATLSTWSLASADCCEWDHVRCDEAGRVNNVFIDGANDVRGQIPSAVAGLTALMSLSL FRLPGLSGPIPACLTALSNLQFLTISHTNVSGVIPDSLARIRSLDSVDLSHNSLTGPI PNSFSDLPNLRSLDLRSNKLTGCIPAGLVQGQFRSLILSYNQLTGPIPRDDAQDEINT VDLSHNRLTGDASFLFAAGRPIGKVDLSWNDLDFDLSKLVFPPELTYLDLSHNRIRGT VPRSLAALSTLQTLDLSYNRLCGPLPRLHGVIRHGCKPYEHNQCAGGAPLGGCHQS</aaseq>|
| |
| − | DNA = <dnaseqindica>60..1058#actcactcacacacactcaagccagctccagccacacgagcctagttcaggtagatacaatggcgtccaccgcctctttcatgctcgccgtcttgctggcggtggccgtcgcggcggcgccggcgagggcggtgcgatgcccgccgagcgacaagcaggcgctgatgagagtgaagcagtcgctgggaaacccggcgacgctgtcgacgtggtccctggcgtcggcggactgctgcgagtgggaccacgtccggtgcgacgaggccgggcgcgtgaacaacgtcttcatcgacggcgccaacgacgtccgcggccagatcccgtccgccgtggcggggctgacggcgctcatgtcgctgtcgctgttccgcctcccgggcctctccggccccatcccggcgtgcctcaccgcgctctccaacctccagttcctcaccatctcccacaccaacgtctccggcgtcatcccggactcgctcgcgcggatccgcagcctcgactccgtcgacctctcccacaacagcctgaccggccccatcccgaactccttctccgacctcccgaacctccggtcgcttgacctccgcagcaacaagctgacgggttgcatcccggcggggctcgtgcaggggcagttcaggtcgctgatcctctcctacaaccagctcaccggcccgatcccgcgcgacgacgcgcaggacgagatcaacaccgtcgacctctcgcacaaccgcctcaccggcgacgcctccttcctcttcgccgccggccggcccatcggcaaggtggacctctcgtggaacgacctcgacttcgacctcagcaagctcgtcttcccgccggagctcacctacctggacctcagccacaaccgcatcaggggcaccgtgccacgctccctcgccgcgctctccacgctgcagacgctggacctcagctacaaccgcctctgcggcccgctcccgaggctgcacggcgtcatccgccacggctgcaagccgtacgagcacaaccagtgcgccggcggcgccccgctcggcgggtgccaccaatcgtgagcatccatccatccatcaccgccggcgagctgatgctgccacgtaaggtggagcccggggtgcgtaacggtatacgtgtttggtgttttttcgcgtacggggacgtggccgtgtagtacacggtacgacgggtgcagccgtgcagggtactgggcgggtttacgttagtacaaattgtaaccaaggtagagtgcctgcacgcgtgcgtggtcgactctccttcagattgtacgaaacgagggagccgtgtgtacgtgtgcgtacgtgtaccgtgtatggagtacgatgatgatgatgatgcaagtgtgtgtattgtgaatgtacgttatggatcgccctaatgtatcatcgaaatgataagtgtttgatataatttgcctttcgttcttgt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066567.1 RefSeq:Os07g0568700]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
The OsFOR1(Oryza sativa floral organ regulator 1) gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice.
Annotated Information
Function
OsFOR1 plays a role in the formation and/or maintenance of floral organ primordia.the OsFOR1 recombinant protein, when fused to maltose-binding protein (MBP), shows PGIP activity against the Aspergillus niger polygalacturonase. Antisense expression of OsFOR1 resulted in an increase in the numbers of floral organs, including the stamen, carpel, palea/lemma, stigma, and lodicule.
Expression
Expression pattern of OsFOR1.
The OsFOR1 (Oryza sativa floral organ regulator 1) gene encodes a protein that contains a leucine-rich repeat (LRR) domain. This domain comprises 10 tandem repeats of a canonical 24-amino acid LRR sequence. The structure and the number of LRRs for OsFOR1 are similar to those of polygalacturonase-inhibiting proteins (PGIPs) from various other plant species.OsFOR1 is highly expressed in the calli and immature and mature panicles, while detectable at only low levels in seedling roots and mature stems. In situ hybridization experiments showed the transcripts of OsFOR1 are present in young spikelet primordia and in almost all of the young floral organs.
Phenotypes of OsFOR1antisense transgenic spikelets.
Evolution
OsFOR1 protein shows high sequence similiarity with the LRR domain proteins of the PGIP family from various dicotyledonous species including Actinidia deliciosa, Malus× domestica, Citrus sp. cv. Sainumphung, Antirrhinum majus, Arabidopsis thaliana,and Daucus carota
Schematic representation of OsFOR1.
Labs working on this gene
- Y.H. Moon for providing the cDNA library of rice panicles
- J. Nam and S. Kim for DNA sequencing
- S.K. Kim and S.I. Kim for maintaining the transgenic rice plants
- Priscilla Licht for critical reading of the manuscript
- Monsanto for providing the OsFOR1 genomic DNA sequences
- NRL program,Korea Instituteof Science and Technology Evaluation and Planning,the Crop Functional Genomic Center, the 21 Century Frontier Program (CG1111 and CG1114), the Biogreen 21 program,Rural Development Administration,the BK21 program, Ministry of Education,POSCO provide the grants.
References
- Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An;The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice;Plant Molecular Biology, 2003, 53(3): 357-372.
- Becraft, P.W. Receptor kinase signaling in plant development.Annu. Rev. Cell. Dev. Biol.2002.18: 163–192.
Structured Information