Difference between revisions of "Os07g0666900"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(11 intermediate revisions by one other user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*OsNHX1, functions as a Na<sup>+</sup>‡and H<sup>+</sup>‡exchanger and plays important roles in salt tolerance of rice<ref name="ref1"/><ref name="ref2"/><ref name="ref3"/><ref name="ref4"/><ref name="ref5"/><ref name="ref6"/>. ''OsNHX1'' may play an important role in the salt tolerance of shoots rather than roots<ref name="ref5"/>.
 +
 +
*''OsNHX1'' plays important roles in the compartment of Na<sup>+</sup> from the cytoplasm of cells into the vacuoles in both of the tissues<ref name="ref2"/><ref name="ref5"/>.
 +
 
 +
*Expression of ''OsNHX1'' under the constitutive promoter Actin1D can confer enhanced salinity tolerance in transgenic rice plants. It also function towards alleviation of toxic effects of salt stress at all stages of the life cycle from seedling to maturity<ref name="ref3"/>.
 +
 
 +
*''OsNHX1'' has the ability to suppress Na+, Li+ and hygromycin sensitivity of yeast ''nhx1'' mutants and sensitivity to a high K+ concentration, a novel phenotype of the ''nhx1'' mutants<ref name="ref5"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0006814 GO:0006814], [http://amigo.geneontology.org/amigo/term/GO:0006885 GO:0006885], [http://amigo.geneontology.org/amigo/term/GO:0015299 GO:0015299], [http://amigo.geneontology.org/amigo/term/GO:0015385 GO:0015385], [http://amigo.geneontology.org/amigo/term/GO:0016021 GO:0016021]
  
 
===Mutation===
 
===Mutation===
 +
[[File: OsNHX1-OE transgenic.jpg|right|thumb|300px|'''Figure 1.''''' RT-PCR of OsNHX1-OE transgenic plants.(from reference <ref name="ref1"/>).'']]
 +
1. Overexpression lines of ''OsNHX1''<ref name="ref1"/>:
 +
*T4
 +
*T5
 +
*T6
  
 +
2. Transgenic lines:''OsNHX1''-OE<ref name="ref1"/>.
 +
 +
3. OsNHX1-143 transgenic rice VS. wild-type:<ref name="ref3"/><br>
 +
*By using Agrobacterium- mediated transformation three independent T0 transgenic lines were produced from which Actin 1DOsNHX1-143 was found to be the most prominent event after molecular and stress tolerance analysis.
 +
 +
*The increased accumulation of Na+ in transgenic lines through the over-expression of ''OsNHX1''. The increased accumulation of Na<sup>+</sup>‡ion in the vacuoles may be responsible for alleviating the toxic effects of excessive Na<sup>+</sup> ion in the cytosol.
 +
 +
*In the case of variety, the transgenic line showed significantly higher spikelet number and yield compared to the wild-type. In the case of Variety x Treatment, only spikelet number was found to be significantly higher in transgenic plants compared to the wild-type
 +
 +
4. ''ena1-4△'' ''nha1△'' ''nhx1△''<ref name="ref4"/>:<br> 
 +
A triple mutant strain of Saccharomyces cerevisiae lacking its own Na+-ATPases and Na+/H+ antiporters (''ena1-4△'' ''nha1△'' ''nhx1△'') was used for the expression of the Oryza sativa NHX1 gene encoding a putative vacuolar Na+/H+ exchanger.
 +
 +
5. Yeast ''nhx1'' mutants lines<ref name="ref5"/>:
 +
*''osnhx1-1''
 +
*''osnhx1-2''<br>
 +
''nhx1'' mutants were sensitive to a high K<sup>+</sup> concentration in APG medium.
 +
 +
6. transgenic cell lines<ref name="ref5"/>:
 +
*95-1-35
 +
*95-5-169
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*In young leaves, three OsNHX1-OE(T4, T5, T6) lines showed high expression by the genes of interests<ref name="ref1"/>.
 +
*The expression of ''OsNHX1'' was differently expressed in roots and shoots, and was stimulated by salt stress in both of the tissues, suggesting that ''OsNHX1'' plays important roles in the compartment of Na<sup>+</sup>‡from the cytoplasm of cells into the vacuoles in both of the tissues<ref name="ref2"/>.
 +
 
 +
*Over-expression of ''OsNHX1'' under Actin1D promoter was confirmed by semi-quantitative RT-PCR and Western Dot-Blot analyses. At 160 mM salt stress, transgenic seedlings grew well and showed minimal reduction in shoot and root length compared to controls. Leaf chlorophyll estimation assay at 160 mM NaCl showed significantly high chlorosis in wild-type in contrast to the transgenic line. After salt stress, lower K<sup>+</sup>/Na<sup>+</sup> ratio in transgenic leaf compared to the wild-type indicated the increased Na+ accumulation in vacuoles. At reproductive stage transgenic plants showed improved yield charateristics compared to the wild-type after exposure to 60 mM NaCl stress<ref name="ref3"/>.
 +
 
 +
*The expression of ''O. sativa Nhx1'' antiporter in ''S. cerevisiae'' revealed that ''OsNhx1p'' is a transport system with broad substrate specificity for at least four alkali metal cations (Li<sup>+</sup>, Na<sup>+</sup>, K<sup>+</sup> and Rb<sup>+</sup>) and that it is able to substitute the function of yeast endosomal Na<sup>+</sup>/H<sup>+</sup>-antiporter ''ScNhx1p''<ref name="ref4"/>. 
 +
 
 +
*''OsNHX1'' gene encodes a vacuolar (Na<sup>+</sup>, K<sup>+</sup>)/H<sup>+</sup> antiporter that has activity similar to that of the ''ScNHX1'' protein<ref name="ref5"/>.
 +
 
 +
*The expression of ''OsNHX1'', ''OsNHX2'', ''OsNHX3'', and ''OsNHX5'' is regulated differently in rice tissues and is increased by salt stress, hyperosmotic stress, and ABA<ref name="ref6"/>. ''OsNHX'' expression was also enhanced under submergence, and the levels of ''OsNHX1'' and ''OsNHX5'' transcripts agreed well with those of seedling vigor under submergence<ref name="ref7"/>.
 +
 
 +
*Expression of Na<sup>+</sup>/H<sup>+</sup> exchanger gene OsNHX was also enhanced by submergence stress and the level of enhancement appeared to agree with the level of seedling vigor among the four cultivars studied, indicating the necessity of further study of its role in seedling vigor under submergence in rice<ref name="ref7"/>.
  
 
===Location===
 
===Location===
 +
*''Nass and Rao''<ref name="ref8"/> showed that NHX1 was localized in prevacuolar compartments and a member of the newly identified cluster that shared intracellular localization. In addition, NHE6 has been reported to have a mitochondrial distribution<ref name="ref9"/> ,which suggesting that ''OsNHX1'' is localized in the intracellular membrane.
  
 +
*subcellular localization:<br>
 +
Analysis using rice cells expressing a fusion protein of ''OsNHX1'' and green fluorescent protein and Western blot analysis using antibodies specific for ''OsNHX1'' confirmed the localization of ''OsNHX1'' on the tonoplasts, which indicating that the ''OsNHX1'' gene encodes a vacuolar (Na<sup>+</sup>, K<sup>+</sup>)/H<sup>+</sup> antiporter<ref name="ref5"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: Na,H ‡exchanger proteins.jpg|right|thumb|250px|'''Figure 2.''''' Phylogenetic analysis of Na<sup>+</sup>/H<sup>+</sup>‡ exchanger proteins.(from reference <ref name="ref2"/>).'']]
 +
*Recently a Na<sup>+</sup>/H<sup>+</sup> exchanger gene (''AtNHX1'') homologous to NHX1 has been cloned in  ''Arabidopsis thaliana''. The deduced amino acid sequence (''OsNHX1'') has high similarity with ''AtNHX1'' (73%), and is similar to NHX1 and mammalian NHE with 26-33% identity. ''OsNHX1'' shares high similarity with ''AtNHX1'', ''NHX1'', and mammalian NHE within predicted transmembrane segments ,which suggesting that ''OsNHX1'' functions as a Na<sup>+</sup>/H<sup>+</sup>‡exchanger<ref name="ref2"/>.
  
You can also add sub-section(s) at will.
+
*Phylogenetic analysis of various Na<sup>+</sup>/H<sup>+</sup> exchangers indicated that ''OsNHX1'', ''AtNHX1'', ''NHX1'', and ''NHE6'' share a cluster distinguished from previously known clusters of other exchangers corresponding to the plasma membrane isoforms of NHEs, bacterial Nha, and yeast Sod2-like exchangers(Fig. 2). ''OsNHX1'' has low similarity with Sod2 of ''S. pombe'', and NhaA and NhaB of ''E. coli''. Phylogenetic analysis revealed that these exchangers share distinct groups from NHX1 and NHEs (Fig. 2)<ref name="ref2"/>.
  
 
===Knowledge Extension===
 
===Knowledge Extension===
 +
The observed mode of ''OsACS'', ''OsACO'' and ''OsNHX'' expression under submergence suggests that these genes can be potential targets for understanding the mechanism regulating seedling vigor under submergence at the post-germination stage in rice<ref name="ref7"/>.
 +
 +
The Na<sup>+</sup>/H<sup>+</sup>‡exchanger that catalyzes the exchange of Na<sup>+</sup>‡for H<sup>+</sup>‡across membranes, contributes to regulation of internal pH, cell volume, and sodium level in the cytoplasm<ref name="ref10"/>.
 +
  
 +
Na<sup>+</sup>/H<sup>+</sup> antiporters, which catalyze the exchange of Na<sup>+</sup> for H<sup>+</sup> across membranes, contribute to the regulation of internal pH, cell volume and the sodium level in the cytoplasm<ref name="ref11"/><ref name="ref12"/>. The antiporters are widespread membrane proteins found in animals, yeasts, bacteria and plants. In particular, vacuolar Na<sup>+</sup>/H<sup>+</sup> antiporters, which compartmentalize Na<sup>+</sup> into the vacuoles for detoxification, have been investigated as the key to salt tolerance in yeasts and plants<ref name="ref13"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, People’s Republic of China
 +
*College of Chemistry and Life Science, Three Gorges University, Yichang 443002, People’s Republic of China
 +
*Department of Life Science, Hunan University of Arts and Science, Changde 415000, China;
 +
*State Key Laboratory of Plant Physiology and Biochemistry, College of Biological Sciences, China Agricultural University, Beijing 100094, China;
 +
*Research Institute of Forestry, Chinese Academy of Forestry, Beijing 100091, China
 +
*Department of Biochemistry and Molecular Biology, University of Dhaka, Bangladesh
 +
*Department of Biochemistry and Molecular Biology, Jahangirnagar University, Savar, Bangladesh
 +
*Department of Plant Physiology, National Institute of Agrobiological Resources, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
 +
*Institute of Biological Sciences, University of Tsukuba, Tennoudai 1-1-1, Tsukuba, Ibaraki 305, Japan
 +
*Institute of Physiology, Academy of Sciences of the Czech Republic, 142 20 Prague 4, Czechia
 +
*Kobe University, Graduate School of Agricultural Science, Kobe, Japan
 +
*Agricultural Genetics Institute (AGI), Department of Molecular Biology, Hanoi, Vietnam
 +
*Philippine Rice Research Institute (PhilRice), Plant Breeding and Biotechnology Division, Science City of Munoz, Philippines
 +
*Hyogo Institute of Agriculture, Forestry and Fishery, Kasai, Japan Published online: 16 Apr 2014.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Liu S, Zheng L, Xue Y, et al. Overexpression of OsVP1 and OsNHX1 increases tolerance to drought and salinity in rice[J]. Journal of Plant Biology, 2010, 53(6): 444-452.
 +
</ref>
 +
* <ref name="ref2">
 +
Fukuda A, Nakamura A, Tanaka Y. Molecular cloning and expression of the Na< sup>+</sup>/H< sup>+</sup> exchanger gene in< i> Oryza sativa</i>[J]. Biochimica et Biophysica Acta (BBA)-Gene Structure and Expression, 1999, 1446(1): 149-155.
 +
</ref>
 +
* <ref name="ref3">
 +
Islam S M, Tammi R S, Malo R, et al. Constitutive expression of OsNHX1 under the promoter Actin1D can improve the salt tolerance and yield characteristics of Bangladeshi rice Binnatoa[J]. Australian Journal of Crop Science, 2009, 3(6): 329.
 +
</ref>
 +
* <ref name="ref4">
 +
Kinclova-Zimmermannova O, Flegelova H, Sychrova H. Rice Na+/H+-antiporter Nhx1 partially complements the alkali-metal-cation sensitivity of yeast strains lacking three sodium transporters[J]. Folia microbiologica, 2004, 49(5): 519-525.
 +
</ref>
 +
* <ref name="ref5">
 +
Fukuda A, Nakamura A, Tagiri A, et al. Function, intracellular localization and the importance in salt tolerance of a vacuolar Na+/H+ antiporter from rice[J]. Plant and Cell Physiology, 2004, 45(2): 146-159.
 +
</ref>
 +
* <ref name="ref6">
 +
Fukuda A, Nakamura A, Hara N, et al. Molecular and functional analyses of rice NHX-type Na+/H+ antiporter genes[J]. Planta, 2011, 233(1): 175-188.
 +
</ref>
 +
* <ref name="ref7">
 +
Vu H T T, Manangkil O E, Mori N, et al. Induction and Repression of Gene Expression Mediating Ethylene Biosynthesis and Sodium/Proton Exchange in Rice Seedlings Under Submergence Stress[J]. Biotechnology & Biotechnological Equipment, 2012, 26(3): 2945-2951.
 +
</ref>
 +
* <ref name="ref8">
 +
Nass R, Rao R. Novel localization of a Na+/H+ exchanger in a late endosomal compartment of yeast Implications for vacuole biogenesis[J]. Journal of Biological Chemistry, 1998, 273(33): 21054-21060.
 +
</ref>
 +
* <ref name="ref9">
 +
Numata M, Petrecca K, Lake N, et al. Identification of a mitochondrial Na+/H+ exchanger[J]. Journal of Biological Chemistry, 1998, 273(12): 6951-6959.
 +
</ref>
 +
* <ref name="ref10">
 +
Orlowski J, Grinstein S. Na+/H+ exchangers of mammalian cells[J]. Journal of Biological Chemistry, 1997, 272(36): 22373-22376.
 +
</ref>
 +
* <ref name="ref11">
 +
Aronson P S. Kinetic properties of the plasma membrane Na+-H+ exchanger[J]. Annual Review of Physiology, 1985, 47(1): 545-560.
 +
</ref>
 +
* <ref name="ref12">
 +
Numata M, Orlowski J. Molecular cloning and characterization of a novel (Na+, K+)/H+ exchanger localized to the trans-Golgi network[J]. Journal of Biological Chemistry, 2001, 276(20): 17387-17394.
 +
</ref>
 +
* <ref name="ref13">
 +
Blumwald E, Aharon G S, Apse M P. Sodium transport in plant cells[J]. Biochimica et Biophysica Acta (BBA)-Biomembranes, 2000, 1465(1): 140-151.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0666900|
 
Description = Similar to Na+/H+ antiporter NHX6|
 
Version = NM_001067106.1 GI:115473944 GeneID:4344217|
 
Length = 4884 bp|
 
Definition = Oryza sativa Japonica Group Os07g0666900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:28824582..28829465|
 
CDS = 28824892..28825065,28825168..28825286,28826171..28826268,28826391..28826450,28826549..28826595<br>,28826676..28826870,28826973..28827019,28827100..28827166,28827258..28827358<br>,28827462..28827563,28827641..28827779,28827857..28827919,28828060..28828143<br>,28828718..28829032|
 
GCID = <gbrowseImage1>
 
name=NC_008400:28824582..28829465
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:28824582..28829465
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>ggcatggggatggaggtggcggcggcgcggctgggggctctgtacacgacctccgactacgcgtcggtggtgtccatcaacctgttcgtcgcgctgctctgcgcctgcatcgtcctcggccacctcctcgaggagaatcgctgggtcaatgagtccatcaccgcgctcatcatcgggctctgcaccggcgtggtgatcttgctgatgaccaaagggaagagctcgcacttattcgtcttcagtgaggatctcttcttcatctacctcctccctccgatcatcttcaatgcaggttttcaggtaaagaaaaagcaattcttccggaatttcatgacgatcacattatttggagccgtcgggacaatgatatcctttttcacaatatctattgctgccattgcaatattcagcagaatgaacattggaacgctggatgtaggagattttcttgcaattggagccatcttttctgcgacagattctgtctgcacattgcaggtcctcaatcaggatgagacaccctttttgtacagtctggtattcggtgaaggtgttgtgaacgatgctacatcaattgtgcttttcaacgcactacagaactttgatcttgtccacatagatgcggctgtcgttctgaaattcttggggaacttcttttatttatttttgtcgagcaccttccttggagtatttgctggattgctcagtgcatacataatcaagaagctatacattggaaggcattctactgaccgtgaggttgcccttatgatgctcatggcttacctttcatatatgctggctgagttgctagatttgagcggcattctcaccgtattcttctgtggtattgtaatgtcacattacacttggcataacgtcacagagagttcaagagttacaacaaagcacgcatttgcaactctgtccttcattgctgagacttttctcttcctgtatgttgggatggatgcattggatattgaaaaatgggagtttgccagtgacagacctggcaaatccattgggataagctcaattttgctaggattggttctgattggaagagctgcttttgtattcccgctgtcgttcttgtcgaacctaacaaagaaggcaccgaatgaaaaaataacctggagacagcaagttgtaatatggtgggctgggctgatgagaggagctgtgtcgattgctcttgcttacaataagtttacaagatctggccatactcagctgcacggcaatgcaataatgatcaccagcaccatcactgtcgttctttttagcactatggtatttgggatgatgacaaagccattgatcaggctgctgctaccggcctcaggccatcctgtcacctctgagccttcatcaccaaagtccctgcattctcctctcctgacaagcatgcaaggttctgacctcgagagtacaaccaacattgtgaggccttccagcctccggatgctcctcaccaagccgacccacactgtccactactactggcgcaagttcgacgacgcgctgatgcgaccgatgtttggcgggcgcgggttcgtgcccttctcccctggatcaccaaccgagcagagccatggaggaagatga</cdnaseq>|
 
AA = <aaseq>GMGMEVAAARLGALYTTSDYASVVSINLFVALLCACIVLGHLLE                    ENRWVNESITALIIGLCTGVVILLMTKGKSSHLFVFSEDLFFIYLLPPIIFNAGFQVK                    KKQFFRNFMTITLFGAVGTMISFFTISIAAIAIFSRMNIGTLDVGDFLAIGAIFSATD                    SVCTLQVLNQDETPFLYSLVFGEGVVNDATSIVLFNALQNFDLVHIDAAVVLKFLGNF                    FYLFLSSTFLGVFAGLLSAYIIKKLYIGRHSTDREVALMMLMAYLSYMLAELLDLSGI                    LTVFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETFLFLYVGMDALDIEKWEFA                    SDRPGKSIGISSILLGLVLIGRAAFVFPLSFLSNLTKKAPNEKITWRQQVVIWWAGLM                    RGAVSIALAYNKFTRSGHTQLHGNAIMITSTITVVLFSTMVFGMMTKPLIRLLLPASG                    HPVTSEPSSPKSLHSPLLTSMQGSDLESTTNIVRPSSLRMLLTKPTHTVHYYWRKFDD                    ALMRPMFGGRGFVPFSPGSPTEQSHGGR</aaseq>|
 
DNA = <dnaseqindica>311..484#587..705#1590..1687#1810..1869#1968..2014#2095..2289#2392..2438#2519..2585#2677..2777#2881..2982#3060..3198#3276..3338#3479..3562#4137..4451#acgaaaagagagagagagagaagagagttttgtagcgagctcgcgcgaatgcgaagccaaccgagagaggtctcgataccaaatcccgatttctcaacctgaatcccccccccacgttcctcgtttcaatctgttcgtctgcgaatcgaattctttgtttttttttctctaattttaccgggaattgtcgaattaggcattcaccaacgagcaagaggggagtggattggttggttaaagctccgcatcttgcggcggaaatctcgctctcttctctgcggtgggtggccggagaagtcgccgccggtgaggcatggggatggaggtggcggcggcgcggctgggggctctgtacacgacctccgactacgcgtcggtggtgtccatcaacctgttcgtcgcgctgctctgcgcctgcatcgtcctcggccacctcctcgaggagaatcgctgggtcaatgagtccatcaccgcgctcatcatcgtaagcgcacacacaccattgctgtgattgattgatcgattgattcgccattgttgctgacgcacgcttgctgctcgatgatttgcttgcttgcttgggcaggggctctgcaccggcgtggtgatcttgctgatgaccaaagggaagagctcgcacttattcgtcttcagtgaggatctcttcttcatctacctcctccctccgatcatcttcaatgcagggtaagtagaaacgcttcggcgtgttcttgctgtggttagatttcggcttcagttcttttgttggcacatggtggtgtacaaggtttttctggggattggggaatctgtttgctgctggtggtacactgtgtacgcgtggctggtttcttgtttgtttcttctgggcctagctgtctgtccgtcgatgtcttagacatggctgctagttcatactgtgcaggttgtgggtgaattttttttttgttttctctttaagacagagatggatttactctcgtcttactggcataccttgacttgccagctcgaactgctgattggtacagtatggagtagcaactgtaatcttgaccattgcatgaagcattgagaaatgctgaaagattatttgttttttaattttaattattatatattgattgactgtgcaacagcttctgtctcctagagttctactcttggtccatttacagtggttagtagtactggtcatccaacaccatgaaggcatgagagggatatggtcctgtcaagagtgatggcgtgatcaatttctgaaagaacagtggccatgctagtccgaatttggttgagcatttaatccccttttgaaggtttttgggccatccatatagatttgaagtagggttgtaggagtaaagctgaatattatgggcccatgtttgctttcacatttaggaattgcaaagtctctctttgggaaagggcacaagtcctttttgagttcagagttactctattttcgttccttttctgctttgcttgaacttttattttttttattcatataataacacaagttgctgaataattctacgggaaaaaaagcatcgtcctggtcctcacaaatatttttccatcagttttcaggtaaagaaaaagcaattcttccggaatttcatgacgatcacattatttggagccgtcgggacaatgatatcctttttcacaatatctattggtacgttctttcagaaatgattcttaattcttccgtgagttggtagtgctttcattttctgttgttccgtgtaaccttttggacttctgagattctgactctgatcaatttcttaatttcagctgccattgcaatattcagcagaatgaacattggaacgctggatgtaggagattttcttggtaagccatggctatctttctgcatgatcatgctggcactaatattgacaccatgtgagcatcatttcctcctgttgactgttatgttcaatgtgcagcaattggagccatcttttctgcgacagattctgtctgcacattgcaggttagttgaacaaattttgccatacctcgagagagacctggattcaacgtgctaatgtaatgatcttaaccccaaaacaggtcctcaatcaggatgagacaccctttttgtacagtctggtattcggtgaaggtgttgtgaacgatgctacatcaattgtgcttttcaacgcactacagaactttgatcttgtccacatagatgcggctgtcgttctgaaattcttggggaacttcttttatttatttttgtcgagcaccttccttggagtatttgtaagttgattcttaagtttcactttttacatcttactgtctgtcttgactctactgcttggttgacacatgtaaacttaatattcttcttccaccctgcaggctggattgctcagtgcatacataatcaagaagctatacattggaaggttagttaagcccaaacaaaccctcattagttaacggttttatgctcagtgttaacttggatgttggtgactgattccaggcattctactgaccgtgaggttgcccttatgatgctcatggcttacctttcatatatgctggctgaggtgtgcctctgctttgatgcagtatcaaaatttgcatatagtttcattttatagtttgattttatctactttgtttgtttgatattggcagttgctagatttgagcggcattctcaccgtattcttctgtggtattgtaatgtcacattacacttggcataacgtcacagagagttcaagagttacaacaaagtaaattataattctcattccatattctactgtttaatgattagcttcagttcgtagaaaaactaaacaaaacttactggtttgttttgtcctttcacctcaggcacgcatttgcaactctgtccttcattgctgagacttttctcttcctgtatgttgggatggatgcattggatattgaaaaatgggagtttgccagtgacaggtctgatacatgttctcatacctaattcctatttatggatatggagactcaattttacttctctttcccattcgcagacctggcaaatccattgggataagctcaattttgctaggattggttctgattggaagagctgcttttgtattcccgctgtcgttcttgtcgaacctaacaaagaaggcaccgaatgaaaaaataacctggagacagcaagtgagtatctggtgtatgatcagacaattttcatttgaattcgacttgccatctgctaactgaatttctctcgataggttgtaatatggtgggctgggctgatgagaggagctgtgtcgattgctcttgcttacaataaggtcagtccgtcagtgcaagactattgcttcacaccatctgtatatctgtatttctcttctcatcttgccattaattagtcccaggagaagtatgtcttagtttcttctccttaagcttaactgtctcgttgcaattgcagtttacaagatctggccatactcagctgcacggcaatgcaataatgatcaccagcaccatcactgtcgttctttttagcactatggtgagtcatcttactgcaacctatgcctaacgcaaagcgtcctcttttcatccaagtttgtgccacatgtctgaattctcaccctaaacaggacctcagcattaagctaacctaataataagttcctcaaagtcgattgtcaaatcaaaattgtcagctgtgacaaaagtaatctggaagcttgtaatgttgaacatgctctaatccaaccaaaaccaactactgaccggagaatgaaatcatgtctttttgtccctactatcttgtcctcttcttatcccttctgaagagattgccgtaccgtccagtcattgactcatcgtccatattctcacatgacatggatcaaggatggcacaattatttgaaattaattgtcgtttgttactactagcttttcgttttagttttctggatgtttctttaggaagacatacatgtgtcatcatgtcgaattgcgcatccaatcacttgattgtttacgagctaaatccttgttcagaatccctggaagctcaaatgtgcaaaacatctatttttgtgaaacatactgacatttataaatgtttattaggtatttgggatgatgacaaagccattgatcaggctgctgctaccggcctcaggccatcctgtcacctctgagccttcatcaccaaagtccctgcattctcctctcctgacaagcatgcaaggttctgacctcgagagtacaaccaacattgtgaggccttccagcctccggatgctcctcaccaagccgacccacactgtccactactactggcgcaagttcgacgacgcgctgatgcgaccgatgtttggcgggcgcgggttcgtgcccttctcccctggatcaccaaccgagcagagccatggaggaagatgaacagtgcaaagaaatgagaatggaatggttgatgaggagaatacatgtaaaatgtgacagcaaaagagagaaggcaagttttgggtttgtagagtttggctgctgctaatgagttgttgatagtgcctatattcttcagaacttcagatggtgcctcaccaaggcctaagagccaggaggaccttctgataatggttcgggatgattggtttgttctgtcaggatgaaccctagtgagtgacacagggtgatgtgctccgacaacctgtaaattttgtagattaacagccccatttgtacctgtctaccatctttagttggcgggtgttctttcctagttgccaccctgcatgtaaaatgaaattctccgccaaaatagatttgtgtgtataataattttgcttggttgatataatggtatggcatggtttgc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067106.1 RefSeq:Os07g0666900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:49, 12 June 2015

OsNHX1(Os07g0666900), is a Na+ and H+ exchanger in rice (Oryza sativa)[1][2][3][4][5][6][7].

Annotated Information

Function

  • OsNHX1, functions as a Na+‡and H+‡exchanger and plays important roles in salt tolerance of rice[1][2][3][4][5][6]. OsNHX1 may play an important role in the salt tolerance of shoots rather than roots[5].
  • OsNHX1 plays important roles in the compartment of Na+ from the cytoplasm of cells into the vacuoles in both of the tissues[2][5].
  • Expression of OsNHX1 under the constitutive promoter Actin1D can confer enhanced salinity tolerance in transgenic rice plants. It also function towards alleviation of toxic effects of salt stress at all stages of the life cycle from seedling to maturity[3].
  • OsNHX1 has the ability to suppress Na+, Li+ and hygromycin sensitivity of yeast nhx1 mutants and sensitivity to a high K+ concentration, a novel phenotype of the nhx1 mutants[5].


GO assignment(s): GO:0006814, GO:0006885, GO:0015299, GO:0015385, GO:0016021

Mutation

Figure 1. RT-PCR of OsNHX1-OE transgenic plants.(from reference [1]).

1. Overexpression lines of OsNHX1[1]:

  • T4
  • T5
  • T6

2. Transgenic lines:OsNHX1-OE[1].

3. OsNHX1-143 transgenic rice VS. wild-type:[3]

  • By using Agrobacterium- mediated transformation three independent T0 transgenic lines were produced from which Actin 1DOsNHX1-143 was found to be the most prominent event after molecular and stress tolerance analysis.
  • The increased accumulation of Na+ in transgenic lines through the over-expression of OsNHX1. The increased accumulation of Na+‡ion in the vacuoles may be responsible for alleviating the toxic effects of excessive Na+ ion in the cytosol.
  • In the case of variety, the transgenic line showed significantly higher spikelet number and yield compared to the wild-type. In the case of Variety x Treatment, only spikelet number was found to be significantly higher in transgenic plants compared to the wild-type

4. ena1-4△ nha1△ nhx1△[4]:
A triple mutant strain of Saccharomyces cerevisiae lacking its own Na+-ATPases and Na+/H+ antiporters (ena1-4△ nha1△ nhx1△) was used for the expression of the Oryza sativa NHX1 gene encoding a putative vacuolar Na+/H+ exchanger.

5. Yeast nhx1 mutants lines[5]:

  • osnhx1-1
  • osnhx1-2

nhx1 mutants were sensitive to a high K+ concentration in APG medium.

6. transgenic cell lines[5]:

  • 95-1-35
  • 95-5-169

Expression

  • In young leaves, three OsNHX1-OE(T4, T5, T6) lines showed high expression by the genes of interests[1].
  • The expression of OsNHX1 was differently expressed in roots and shoots, and was stimulated by salt stress in both of the tissues, suggesting that OsNHX1 plays important roles in the compartment of Na+‡from the cytoplasm of cells into the vacuoles in both of the tissues[2].
  • Over-expression of OsNHX1 under Actin1D promoter was confirmed by semi-quantitative RT-PCR and Western Dot-Blot analyses. At 160 mM salt stress, transgenic seedlings grew well and showed minimal reduction in shoot and root length compared to controls. Leaf chlorophyll estimation assay at 160 mM NaCl showed significantly high chlorosis in wild-type in contrast to the transgenic line. After salt stress, lower K+/Na+ ratio in transgenic leaf compared to the wild-type indicated the increased Na+ accumulation in vacuoles. At reproductive stage transgenic plants showed improved yield charateristics compared to the wild-type after exposure to 60 mM NaCl stress[3].
  • The expression of O. sativa Nhx1 antiporter in S. cerevisiae revealed that OsNhx1p is a transport system with broad substrate specificity for at least four alkali metal cations (Li+, Na+, K+ and Rb+) and that it is able to substitute the function of yeast endosomal Na+/H+-antiporter ScNhx1p[4].
  • OsNHX1 gene encodes a vacuolar (Na+, K+)/H+ antiporter that has activity similar to that of the ScNHX1 protein[5].
  • The expression of OsNHX1, OsNHX2, OsNHX3, and OsNHX5 is regulated differently in rice tissues and is increased by salt stress, hyperosmotic stress, and ABA[6]. OsNHX expression was also enhanced under submergence, and the levels of OsNHX1 and OsNHX5 transcripts agreed well with those of seedling vigor under submergence[7].
  • Expression of Na+/H+ exchanger gene OsNHX was also enhanced by submergence stress and the level of enhancement appeared to agree with the level of seedling vigor among the four cultivars studied, indicating the necessity of further study of its role in seedling vigor under submergence in rice[7].

Location

  • Nass and Rao[8] showed that NHX1 was localized in prevacuolar compartments and a member of the newly identified cluster that shared intracellular localization. In addition, NHE6 has been reported to have a mitochondrial distribution[9] ,which suggesting that OsNHX1 is localized in the intracellular membrane.
  • subcellular localization:

Analysis using rice cells expressing a fusion protein of OsNHX1 and green fluorescent protein and Western blot analysis using antibodies specific for OsNHX1 confirmed the localization of OsNHX1 on the tonoplasts, which indicating that the OsNHX1 gene encodes a vacuolar (Na+, K+)/H+ antiporter[5].

Evolution

Error creating thumbnail: File with dimensions greater than 12.5 MP
Figure 2. Phylogenetic analysis of Na+/H+‡ exchanger proteins.(from reference [2]).
  • Recently a Na+/H+ exchanger gene (AtNHX1) homologous to NHX1 has been cloned in Arabidopsis thaliana. The deduced amino acid sequence (OsNHX1) has high similarity with AtNHX1 (73%), and is similar to NHX1 and mammalian NHE with 26-33% identity. OsNHX1 shares high similarity with AtNHX1, NHX1, and mammalian NHE within predicted transmembrane segments ,which suggesting that OsNHX1 functions as a Na+/H+‡exchanger[2].
  • Phylogenetic analysis of various Na+/H+ exchangers indicated that OsNHX1, AtNHX1, NHX1, and NHE6 share a cluster distinguished from previously known clusters of other exchangers corresponding to the plasma membrane isoforms of NHEs, bacterial Nha, and yeast Sod2-like exchangers(Fig. 2). OsNHX1 has low similarity with Sod2 of S. pombe, and NhaA and NhaB of E. coli. Phylogenetic analysis revealed that these exchangers share distinct groups from NHX1 and NHEs (Fig. 2)[2].

Knowledge Extension

The observed mode of OsACS, OsACO and OsNHX expression under submergence suggests that these genes can be potential targets for understanding the mechanism regulating seedling vigor under submergence at the post-germination stage in rice[7].

The Na+/H+‡exchanger that catalyzes the exchange of Na+‡for H+‡across membranes, contributes to regulation of internal pH, cell volume, and sodium level in the cytoplasm[10].


Na+/H+ antiporters, which catalyze the exchange of Na+ for H+ across membranes, contribute to the regulation of internal pH, cell volume and the sodium level in the cytoplasm[11][12]. The antiporters are widespread membrane proteins found in animals, yeasts, bacteria and plants. In particular, vacuolar Na+/H+ antiporters, which compartmentalize Na+ into the vacuoles for detoxification, have been investigated as the key to salt tolerance in yeasts and plants[13].

Labs working on this gene

  • State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, People’s Republic of China
  • College of Chemistry and Life Science, Three Gorges University, Yichang 443002, People’s Republic of China
  • Department of Life Science, Hunan University of Arts and Science, Changde 415000, China;
  • State Key Laboratory of Plant Physiology and Biochemistry, College of Biological Sciences, China Agricultural University, Beijing 100094, China;
  • Research Institute of Forestry, Chinese Academy of Forestry, Beijing 100091, China
  • Department of Biochemistry and Molecular Biology, University of Dhaka, Bangladesh
  • Department of Biochemistry and Molecular Biology, Jahangirnagar University, Savar, Bangladesh
  • Department of Plant Physiology, National Institute of Agrobiological Resources, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
  • Institute of Biological Sciences, University of Tsukuba, Tennoudai 1-1-1, Tsukuba, Ibaraki 305, Japan
  • Institute of Physiology, Academy of Sciences of the Czech Republic, 142 20 Prague 4, Czechia
  • Kobe University, Graduate School of Agricultural Science, Kobe, Japan
  • Agricultural Genetics Institute (AGI), Department of Molecular Biology, Hanoi, Vietnam
  • Philippine Rice Research Institute (PhilRice), Plant Breeding and Biotechnology Division, Science City of Munoz, Philippines
  • Hyogo Institute of Agriculture, Forestry and Fishery, Kasai, Japan Published online: 16 Apr 2014.

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Liu S, Zheng L, Xue Y, et al. Overexpression of OsVP1 and OsNHX1 increases tolerance to drought and salinity in rice[J]. Journal of Plant Biology, 2010, 53(6): 444-452.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 Fukuda A, Nakamura A, Tanaka Y. Molecular cloning and expression of the Na< sup>+</sup>/H< sup>+</sup> exchanger gene in< i> Oryza sativa</i>[J]. Biochimica et Biophysica Acta (BBA)-Gene Structure and Expression, 1999, 1446(1): 149-155.
  3. 3.0 3.1 3.2 3.3 3.4 Islam S M, Tammi R S, Malo R, et al. Constitutive expression of OsNHX1 under the promoter Actin1D can improve the salt tolerance and yield characteristics of Bangladeshi rice Binnatoa[J]. Australian Journal of Crop Science, 2009, 3(6): 329.
  4. 4.0 4.1 4.2 4.3 Kinclova-Zimmermannova O, Flegelova H, Sychrova H. Rice Na+/H+-antiporter Nhx1 partially complements the alkali-metal-cation sensitivity of yeast strains lacking three sodium transporters[J]. Folia microbiologica, 2004, 49(5): 519-525.
  5. 5.0 5.1 5.2 5.3 5.4 5.5 5.6 5.7 5.8 Fukuda A, Nakamura A, Tagiri A, et al. Function, intracellular localization and the importance in salt tolerance of a vacuolar Na+/H+ antiporter from rice[J]. Plant and Cell Physiology, 2004, 45(2): 146-159.
  6. 6.0 6.1 6.2 Fukuda A, Nakamura A, Hara N, et al. Molecular and functional analyses of rice NHX-type Na+/H+ antiporter genes[J]. Planta, 2011, 233(1): 175-188.
  7. 7.0 7.1 7.2 7.3 Vu H T T, Manangkil O E, Mori N, et al. Induction and Repression of Gene Expression Mediating Ethylene Biosynthesis and Sodium/Proton Exchange in Rice Seedlings Under Submergence Stress[J]. Biotechnology & Biotechnological Equipment, 2012, 26(3): 2945-2951.
  8. Nass R, Rao R. Novel localization of a Na+/H+ exchanger in a late endosomal compartment of yeast Implications for vacuole biogenesis[J]. Journal of Biological Chemistry, 1998, 273(33): 21054-21060.
  9. Numata M, Petrecca K, Lake N, et al. Identification of a mitochondrial Na+/H+ exchanger[J]. Journal of Biological Chemistry, 1998, 273(12): 6951-6959.
  10. Orlowski J, Grinstein S. Na+/H+ exchangers of mammalian cells[J]. Journal of Biological Chemistry, 1997, 272(36): 22373-22376.
  11. Aronson P S. Kinetic properties of the plasma membrane Na+-H+ exchanger[J]. Annual Review of Physiology, 1985, 47(1): 545-560.
  12. Numata M, Orlowski J. Molecular cloning and characterization of a novel (Na+, K+)/H+ exchanger localized to the trans-Golgi network[J]. Journal of Biological Chemistry, 2001, 276(20): 17387-17394.
  13. Blumwald E, Aharon G S, Apse M P. Sodium transport in plant cells[J]. Biochimica et Biophysica Acta (BBA)-Biomembranes, 2000, 1465(1): 140-151.

Structured Information