Difference between revisions of "Os07g0694700"

From RiceWiki
Jump to: navigation, search
(Function)
(Structured Information)
 
(13 intermediate revisions by one other user not shown)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Little is known about the individual functions of the APX isozymes in rice, partly because of the difficulty in obtaining sufficient amounts of homogeneous and active isozymes for analysis[1].
+
Little is known about the individual functions of the APX isozymes in rice, partly because of the difficulty in obtaining sufficient amounts of homogeneous and active isozymes for analysis. The authors introduced cDNA clones (APXa and APXb) encoding rice APX isozymes into the expression vector pGEX-6p-3 to allow expression as a glutathione- S-transferase (GST) fusion protein in Escherichia coli, and obtained homogeneous, active recombinant proteins with high yields by using an optimized procedure[1].
 +
[[File:QQ截图20140523223010.jpg]]
 +
[[File:QQ截图20140523224201.jpg]]
 +
[[File:QQ截图20140523224816.jpg]]
  
 
===Expression===
 
===Expression===
RNA gel blot analysis showed that the transcription of the OsAPx2 gene increased significantly with time of exposure to NaCl, NaHCO3, and PEG 6000[1]. APX isozymes occur in several cell compartments and occur in many plants, including Arabidopsis, spinach, pumpkin, tobacco, soybean, potato and rice. Plant APX isoforms act differently in response to stress and in different developmental stages[2]. rice plants that overexpress OsAPXa and have increased APX activity. The effect of increased APX activity on the levels of H(2)O(2) and lipid peroxidation were determined by measuring H(2)O(2) levels and malondialdehyde (MDA) contents in spikelets during cold treatments at the booting stage. The levels of H(2)O(2) and the MDA content increased by 1.5-fold and twofold, respectively in WT plants subjected to a 12 °C treatment for 6 days. In contrast, transgenic lines showed small changes in H(2)O(2) levels and MDA content under cold stress, and H(2)O(2) levels and MDA content were significantly lower than in WT plants. APX activity showed negative correlations with levels of H(2)O(2) and MDA content, which increased during cold treatment. Cold tolerance at the booting stage in transgenic lines and WT plants was evaluated. Spikelet fertility was significantly higher in transgenic lines than in WT plants after a 12 °C treatment for 6 days. These results indicate that higher APX activity enhances H(2)O(2)-scavenging capacity and protects spikelets from lipid peroxidation, thereby increasing spikelet fertility under cold stress[3].
+
RNA gel blot analysis showed that the transcription of the OsAPx2 gene increased significantly with time of exposure to NaCl, NaHCO3, and PEG 6000[2]. APX isozymes occur in several cell compartments and occur in many plants, including Arabidopsis, spinach, pumpkin, tobacco, soybean, potato and rice. Plant APX isoforms act differently in response to stress and in different developmental stages[1]. rice plants that overexpress OsAPXa and have increased APX activity. The effect of increased APX activity on the levels of H(2)O(2) and lipid peroxidation were determined by measuring H(2)O(2) levels and malondialdehyde (MDA) contents in spikelets during cold treatments at the booting stage. The levels of H(2)O(2) and the MDA content increased by 1.5-fold and twofold, respectively in WT plants subjected to a 12 °C treatment for 6 days. In contrast, transgenic lines showed small changes in H(2)O(2) levels and MDA content under cold stress, and H(2)O(2) levels and MDA content were significantly lower than in WT plants. APX activity showed negative correlations with levels of H(2)O(2) and MDA content, which increased during cold treatment. Cold tolerance at the booting stage in transgenic lines and WT plants was evaluated. Spikelet fertility was significantly higher in transgenic lines than in WT plants after a 12 °C treatment for 6 days. These results indicate that higher APX activity enhances H(2)O(2)-scavenging capacity and protects spikelets from lipid peroxidation, thereby increasing spikelet fertility under cold stress[3].
 +
 
 +
[[File:11111.jpg]]
 +
[[File:22222.jpg]]
  
 
===Evolution===
 
===Evolution===
Line 14: Line 20:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
Stress Molecular Biology Laboratory, Northeast Forestry University, Harbin, 150040, P.R. China
 +
 
 +
Asian Natural Environment Science Center (ANESC), The University of Tokyo, Nishitokyo City, Tokyo, Japan
 +
 
 +
Research Laboratory for Agricultural Biotechnology and Biochemistry (RLABB), GPO Box 8207, Kathmandu, Nepal
 +
 
 +
National Institute of Advanced Industrial Science and Technology (AIST), Central 6, 1-1-1 Higashi, Tsukuba, Ibaraki 305-8566, Japan
 +
 
 +
Department of Agronomy, National Taiwan University, Taipei, Taiwan, ROC
  
 
==References==
 
==References==
Please input cited references here.
+
1. Guan Q, Takano T, Liu S. Genetic Transformation and Analysis of Rice OsAPx2 Gene in Medicago sativa[J]. PloS one, 2012, 7(7): e41233.
 +
 
 +
2. Lu Z, Takano T, Liu S. Purification and characterization of two ascorbate peroxidases of rice (Oryza sativa L.) expressed in Escherichia coli[J]. Biotechnology letters, 2005, 27(1): 63-67.
 +
 
 +
3. Sato Y, Masuta Y, Saito K, et al. Enhanced chilling tolerance at the booting stage in rice by transgenic overexpression of the ascorbate peroxidase gene, OsAPXa[J]. Plant cell reports, 2011, 30(3): 399-406.
 +
 
 +
4. Teixeira F K, Menezes-Benavente L, Galvão V C, et al. Rice ascorbate peroxidase gene family encodes functionally diverse isoforms localized in different subcellular compartments[J]. Planta, 2006, 224(2): 300-314.
 +
 
 +
5.  Tsai Y C, Hong C Y, Liu L F, et al. Expression of ascorbate peroxidase and glutathione reductase in roots of rice seedlings in response to NaCl and H(2)O(2). Journal of plant physiology, 2005, 162(3): 291-299.
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os07g0694700|
 
Description = L-ascorbate peroxidase|
 
Version = NM_001067276.1 GI:115474284 GeneID:4344397|
 
Length = 2553 bp|
 
Definition = Oryza sativa Japonica Group Os07g0694700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
 
AP = Chromosome 7:30243906..30246458|
 
CDS = 30244470..30244485,30244580..30244638,30244773..30244875,30244992..30245071,30245161..30245246<br>,30245605..30245653,30245846..30245911,30245997..30246171,30246265..30246386<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008400:30243906..30246458
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008400:30243906..30246458
 
source=RiceChromosome07
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgggcagcaagtcgtacccgacggtgagcgatgagtacctggcggccgtgggcaaggcgaagcgcaagctccgcggcctcatcgccgagaagaactgcgccccactcatgctccgcctcgcgtggcactctgctggcaccttcgatgtgtcgtcgaggaccggcgggcccttcggcaccatgaagaaccccggcgagcagtcccacgccgccaacgccggcctcgacatcgccgtcaggcttctcgaccccatcaaggaccaacttcccatcctctcctacgccgacttctaccagcttgctggcgttgtggccgtcgaggtcaccggcggacctgaggtccccttccatccgggcaggcaggacaagcctgagcctcctcctgaaggccgtcttcctgatgccacacaaggttctgaccacctaaggcaggtcttttctgcgcagatgggtttgagtgacaaggacatagttgctctttctggtggtcacaccctgggaagatgccacaaggagagatctggctttgagggagcctggacgtccaaccctttgatctttgacaactcttacttcaccgagcttgtgagtggcgagaaggaaggccttcttcagctgccaagtgacaaagccctcatggctgacccagccttccgtccactggtggagaaatatgctgcggatgaggacgccttctttgcggattacgccgaggcccacctcaagctctctgaactgggatttgctgaggaataa</cdnaseq>|
 
AA = <aaseq>MGSKSYPTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHS                    AGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAG                    VVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSAQMGLSDKDIVAL                    SGGHTLGRCHKERSGFEGAWTSNPLIFDNSYFTELVSGEKEGLLQLPSDKALMADPAF                    RPLVEKYAADEDAFFADYAEAHLKLSELGFAEE</aaseq>|
 
DNA = <dnaseqindica>1974..1989#1821..1879#1584..1686#1388..1467#1213..1298#806..854#548..613#288..462#73..194#ggtgaggtgaggtgagttgagttggggattgattgattgattcggattgggaagaagaagaagcaggggagcatgggcagcaagtcgtacccgacggtgagcgatgagtacctggcggccgtgggcaaggcgaagcgcaagctccgcggcctcatcgccgagaagaactgcgccccactcatgctccgcctcgcgtaactttcttcttcttcttcttctactgattaatttccagaagatagagtaggaggagtagatgttgaattgcagtggctggctggctgcaggtggcactctgctggcaccttcgatgtgtcgtcgaggaccggcgggcccttcggcaccatgaagaaccccggcgagcagtcccacgccgccaacgccggcctcgacatcgccgtcaggcttctcgaccccatcaaggaccaacttcccatcctctcctacgccgacttctaccaggtaaggttcacttccctcccttcctcccttccttcctctcaactcatcaacctcttaattggagtctctccctctctattggcagcttgctggcgttgtggccgtcgaggtcaccggcggacctgaggtccccttccatccgggcaggcaggtcagaatcacatttcccatccctaaaccctctccctctctctccccccttcttctttcttcttctggtagatgcaaatggtatttttcttaagtcaattcttttctttcgtcatcttgtacgccgctgtttcctttccctgaattctccactgtcttgtgaatgttgatgatgtgatgtgtttgtttctaggacaagcctgagcctcctcctgaaggccgtcttcctgatgccacacaaggtattaagatttcctctgtattaagttacccctatgacaatgcatttcccaatgtgttggtgattaaattttctagatctatgaccagcatttgtatgtgctactgatggagtagttcatattgcaagtccattaccagaattctttcatgcttaagtaagttgtgtaacctacataagactaaaattttccaaccctgtttatgcaaaccacattactaaagtttgttttgtgttcctgtttattcttctttcttatatggagcatacatgttacctgtgtgttctttaattaacagtgtgccaatttgtggatgcgagataactaatatgtcatggtcttctggctgttggtccaggttctgaccacctaaggcaggtcttttctgcgcagatgggtttgagtgacaaggacatagttgctctttctggtggtcacaccctggttggtacacttgtgcaattgccctagtgtgtttctcatatcttgtaaccggaagggttattcatgcagcttcacttcatcttctgtagggaagatgccacaaggagagatctggctttgagggagcctggacgtccaaccctttgatctttgacaactcttacttcacgtgcgtgatctctgattctttttaaagatgcatcctgtctgttgataaacagccagccacagcttgtttccttgtatgctaaagaatgaaaaccaaaatctcctctcgatcaacagcgagcttgtgagtggcgagaaggaaggccttcttcagctgccaagtgacaaagccctcatggctgacccagccttccgtccactggtggagaaatatgctgcggtacaccccttgatccttgcattattttctctcgtcttctttctaaagagttgttttttttaaaataaaagaaataagagaaatggatcatcgttgatctcttaaaaagtagatgattgttgcctgatatgtaggatgaggacgccttctttgcggattacgccgaggcccacctcaagctctctgaactggggtaagggatgcaactggtgtgcttgtctgtgatgcgttattggagtgctttgtgccagagtttcactaattattgttgtgtttgtgggtttcagatttgctgaggaataagaagcctttagagagcgggatatccgcaaaagattaatgccgatttgtattttgcgccttagagtcagtacgatcaagactgtcgtggcggttgtaataaaaattagtgtgctttgggccatctttttatgtgattccaattgtctttctcttcattcttgctttgatgctctttgtctggacctctagaccgccgtattgtactgtggagtttcaaagttaccaagctatttgctgtcaagataactatggattgaattccccttgatggatgaaccaactgttgttgtttgcccgttcttcagctttcgtttgtgcggccatcgatcgccatgcgttgcttaaacccatttctagctcccctaccctgctgcatccgccctcttctgcgcgatcgttggattgcgagtggttggctggttgcacgacttgtggagaccgaaacaaataatttttggtcaaattgatcggtggtactgtcggagcatctattttttctttagcttagatcgtataattgtaggattgggatttgtatattaatatatacaggtcgattaaaac</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067276.1 RefSeq:Os07g0694700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 08:50, 12 June 2015

Please input one-sentence summary here.

Annotated Information

Function

Little is known about the individual functions of the APX isozymes in rice, partly because of the difficulty in obtaining sufficient amounts of homogeneous and active isozymes for analysis. The authors introduced cDNA clones (APXa and APXb) encoding rice APX isozymes into the expression vector pGEX-6p-3 to allow expression as a glutathione- S-transferase (GST) fusion protein in Escherichia coli, and obtained homogeneous, active recombinant proteins with high yields by using an optimized procedure[1]. QQ截图20140523223010.jpg QQ截图20140523224201.jpg QQ截图20140523224816.jpg

Expression

RNA gel blot analysis showed that the transcription of the OsAPx2 gene increased significantly with time of exposure to NaCl, NaHCO3, and PEG 6000[2]. APX isozymes occur in several cell compartments and occur in many plants, including Arabidopsis, spinach, pumpkin, tobacco, soybean, potato and rice. Plant APX isoforms act differently in response to stress and in different developmental stages[1]. rice plants that overexpress OsAPXa and have increased APX activity. The effect of increased APX activity on the levels of H(2)O(2) and lipid peroxidation were determined by measuring H(2)O(2) levels and malondialdehyde (MDA) contents in spikelets during cold treatments at the booting stage. The levels of H(2)O(2) and the MDA content increased by 1.5-fold and twofold, respectively in WT plants subjected to a 12 °C treatment for 6 days. In contrast, transgenic lines showed small changes in H(2)O(2) levels and MDA content under cold stress, and H(2)O(2) levels and MDA content were significantly lower than in WT plants. APX activity showed negative correlations with levels of H(2)O(2) and MDA content, which increased during cold treatment. Cold tolerance at the booting stage in transgenic lines and WT plants was evaluated. Spikelet fertility was significantly higher in transgenic lines than in WT plants after a 12 °C treatment for 6 days. These results indicate that higher APX activity enhances H(2)O(2)-scavenging capacity and protects spikelets from lipid peroxidation, thereby increasing spikelet fertility under cold stress[3].

11111.jpg 22222.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Stress Molecular Biology Laboratory, Northeast Forestry University, Harbin, 150040, P.R. China

Asian Natural Environment Science Center (ANESC), The University of Tokyo, Nishitokyo City, Tokyo, Japan

Research Laboratory for Agricultural Biotechnology and Biochemistry (RLABB), GPO Box 8207, Kathmandu, Nepal

National Institute of Advanced Industrial Science and Technology (AIST), Central 6, 1-1-1 Higashi, Tsukuba, Ibaraki 305-8566, Japan

Department of Agronomy, National Taiwan University, Taipei, Taiwan, ROC

References

1. Guan Q, Takano T, Liu S. Genetic Transformation and Analysis of Rice OsAPx2 Gene in Medicago sativa[J]. PloS one, 2012, 7(7): e41233.

2. Lu Z, Takano T, Liu S. Purification and characterization of two ascorbate peroxidases of rice (Oryza sativa L.) expressed in Escherichia coli[J]. Biotechnology letters, 2005, 27(1): 63-67.

3. Sato Y, Masuta Y, Saito K, et al. Enhanced chilling tolerance at the booting stage in rice by transgenic overexpression of the ascorbate peroxidase gene, OsAPXa[J]. Plant cell reports, 2011, 30(3): 399-406.

4. Teixeira F K, Menezes-Benavente L, Galvão V C, et al. Rice ascorbate peroxidase gene family encodes functionally diverse isoforms localized in different subcellular compartments[J]. Planta, 2006, 224(2): 300-314.

5. Tsai Y C, Hong C Y, Liu L F, et al. Expression of ascorbate peroxidase and glutathione reductase in roots of rice seedlings in response to NaCl and H(2)O(2). Journal of plant physiology, 2005, 162(3): 291-299.

Structured Information