Difference between revisions of "Os08g0167500"

From RiceWiki
Jump to: navigation, search
(CHLORORESPIRATORY REDUCTION 6 (CRR6) 对叶绿体NAD(P)H 脱氢酶(NDH)复合体的亚复合物 A 的聚集是必需的(Yamori et al. 2011)。)
(Structured Information)
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
 
 
The rice gene Os08g0167500 was reported as CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex, is essential for photorespiration in ''Orazy sativa Japonica Group''.
 
The rice gene Os08g0167500 was reported as CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex, is essential for photorespiration in ''Orazy sativa Japonica Group''.
 
==Annotated Information==
 
==Annotated Information==
Hua Pu(蒲华)from Institute of Botany, Chinese Academy of Science.
 
 
===Function===
 
===Function===
Please input function information here.
+
  The role of NAD(P)H dehydrogenase (NDH)‐dependent cyclic electron flow around photosystem I in photosynthetic regulation and plant growth at several temperatures was examined in rice (Oryza sativa) that is defective in CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex (crr6). NdhK was not detected by Western blot analysis in crr6 mutants, resulting in lack of a transient post‐illumination increase in chlorophyll fluorescence, and confirming that crr6 mutants lack NDH activity. When plants were grown at 28 or 35°C, all examined photosynthetic parameters, including the CO2 assimilation rate and the electron transport rate around photosystems I and II, at each growth temperature at light intensities above growth light (i.e. 800 μmol photons m−2 sec−1), were similar between crr6 mutants and control plants. However, when plants were grown at 20°C, all the examined photosynthetic parameters were significantly lower in crr6 mutants than control plants, and this effect on photosynthesis caused a corresponding reduction in plant biomass. The Fv/Fm ratio was only slightly lower in crr6 mutants than in control plants after short‐term strong light treatment at 20°C. However, after long‐term acclimation to the low temperature, impairment of cyclic electron flow suppressed non‐photochemical quenching and promoted reduction of the plastoquinone pool in crr6 mutants. Taken together, our experiments show that NDH‐dependent cyclic electron flow plays a significant physiological role in rice during photosynthesis and plant growth at low temperature.
The role of NAD(P)H dehydrogenase (NDH)‐dependent cyclic electron flow around photosystem I in photosynthetic regulation and plant growth at several temperatures was examined in rice (Oryza sativa) that is defective in CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex (crr6). NdhK was not detected by Western blot analysis in crr6 mutants, resulting in lack of a transient post‐illumination increase in chlorophyll fluorescence, and confirming that crr6 mutants lack NDH activity. When plants were grown at 28 or 35°C, all examined photosynthetic parameters, including the CO2 assimilation rate and the electron transport rate around photosystems I and II, at each growth temperature at light intensities above growth light (i.e. 800 μmol photons m−2 sec−1), were similar between crr6 mutants and control plants. However, when plants were grown at 20°C, all the examined photosynthetic parameters were significantly lower in crr6 mutants than control plants, and this effect on photosynthesis caused a corresponding reduction in plant biomass. The Fv/Fm ratio was only slightly lower in crr6 mutants than in control plants after short‐term strong light treatment at 20°C. However, after long‐term acclimation to the low temperature, impairment of cyclic electron flow suppressed non‐photochemical quenching and promoted reduction of the plastoquinone pool in crr6 mutants. Taken together, our experiments show that NDH‐dependent cyclic electron flow plays a significant physiological role in rice during photosynthesis and plant growth at low temperature.
+
 
 
===Expression===
 
===Expression===
Please input expression information here.
+
  Rice crr6 mutants do not accumulate the NDH complex. CRR6 is a stromal protein that is required for the assembly of NDH sub-complex A in Arabidopsis (Peng et al., 2010), and is encoded by a single-copy gene (Os08g0167500) in rice. The Tos17 retrotransposon was inserted into the exon of this gene (OsCRR6). Homozygous Tos17 insertion plants were identified by PCR analysis from progeny of a heterozygous plant provided by the National Institute of Agrobiological Sciences of Japan. As Tos17 mutant lines may include multiple insertions in a single genome, the crr6 mutant plant was crossed with the wild-type, and the resulting plants containing the homo-zygous wild-type CRR6 allele were used as control plants (+/+) in the experiments described below . As the control plants behaved like wild-type plants in all experi-ments, we describe differences between crr6 mutants and the control plants (+/+). The fact that the TOS17 insertioncaused the mutant phenotype was further confirmed in the generation (see below).
Rice crr6 mutants do not accumulate the NDH complex. CRR6 is a stromal protein that is required for the assembly of NDH sub-complex A in Arabidopsis (Peng et al., 2010), and is encoded by a single-copy gene (Os08g0167500) in rice. The Tos17 retrotransposon was inserted into the exon of this gene (OsCRR6). Homozygous Tos17 insertion plants were identified by PCR analysis from progeny of a heterozygous plant provided by the National Institute of Agrobiological Sciences of Japan. As Tos17 mutant lines may include multiple insertions in a single genome, the crr6 mutant plant was crossed with the wild-type, and the resulting plants containing the homo-zygous wild-type CRR6 allele were used as control plants (+/+) in the experiments described below . As the control plants behaved like wild-type plants in all experi-ments, we describe differences between crr6 mutants and the control plants (+/+). The fact that the TOS17 insertioncaused the mutant phenotype was further confirmed in the generation (see below).
+
  Immunoblot analysis showed that CRR6 was not present in crr6 mutants (Figure 1c). The chloroplast NDH complex is divided into four parts (the A, B, membrane and lumen sub-complexes; Peng et al., 2008, 2011), and CRR6 is required for accumulation of subcomplex A in Arabidopsis (Peng et al.,2008). To study the effect of disruption of CRR6 on accumu-lation of the NDH complex in rice, we assessed the level of NdhK, a subunit of sub-complex A of the NDH complex, in crr6 mutants (Figure 1c). The NdhK level was drastically reduced to below the detection limit in crr6 mutants. Thus,consistent with observations in Arabidopsis (Peng et al.,2010), accumulation of NDH sub-complex A was impaired in rice crr6 mutants.
Immunoblot analysis showed that CRR6 was not present in crr6 mutants (Figure 1c). The chloroplast NDH complex is divided into four parts (the A, B, membrane and lumen sub-complexes; Peng et al., 2008, 2011), and CRR6 is required for accumulation of subcomplex A in Arabidopsis (Peng et al.,2008). To study the effect of disruption of CRR6 on accumu-lation of the NDH complex in rice, we assessed the level of NdhK, a subunit of sub-complex A of the NDH complex, in crr6 mutants (Figure 1c). The NdhK level was drastically reduced to below the detection limit in crr6 mutants. Thus,consistent with observations in Arabidopsis (Peng et al.,2010), accumulation of NDH sub-complex A was impaired in rice crr6 mutants.
+
*mRNA and Protein(s)
 +
NM_001067614.1 → NP_001061079.1  Os08g0167500 [Oryza sativa Japonica Group]
 +
See proteins identical to NP_001061079.1
 +
Status: PROVISIONAL
 +
UniProtKB/TrEMBL|Q6ZCP8
 +
Conserved Domains (1) summary
 +
pfam08847  || DUF1817; Domain of unknown function (DUF1817)
 +
 
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
  Gene ID: 4344752
Gene ID: 4344752
+
  Gene symbol:Os08g0167500
Gene symbol:Os08g0167500
+
  Gene description:Os08g0167500
Gene description:Os08g0167500
+
  Gene type:protein coding
Gene type:protein coding
+
  RefSeq status:PROVISIONAL
RefSeq status:PROVISIONAL
+
  Organism:Oryza sativa Japonica Group (cultivar: Nipponbare)
Organism:Oryza sativa Japonica Group (cultivar: Nipponbare)
+
  Lineage:Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Lineage:Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza
 
You can also add sub-section(s) at will.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
  Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Aoba-ku, Sendai 981-8555, Japan
Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Aoba-ku, Sendai 981-8555, Japan
+
  Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502, Japan
Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502, Japan
 
 
==References==
 
==References==
Please input cited references here.
 
 
   Wataru Yamori;Naoki Sakata;Yuji Suzuki;Toshiharu Shikanai;Amane Makino
 
   Wataru Yamori;Naoki Sakata;Yuji Suzuki;Toshiharu Shikanai;Amane Makino
 
   Cyclic electron flow around photosystem I via chloroplast NAD(P)H dehydrogenase (NDH) complex performs a significant physiological role during photosynthesis and plant growth at low temperature in rice
 
   Cyclic electron flow around photosystem I via chloroplast NAD(P)H dehydrogenase (NDH) complex performs a significant physiological role during photosynthesis and plant growth at low temperature in rice
 
   The Plant Journal, 2011, 68(6): 966-976
 
   The Plant Journal, 2011, 68(6): 966-976
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os08g0167500|
 
Description = Conserved hypothetical protein|
 
Version = NM_001067614.1 GI:115474964 GeneID:4344752|
 
Length = 2049 bp|
 
Definition = Oryza sativa Japonica Group Os08g0167500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:3948087..3950135|
 
CDS = 3948167..3948377,3949066..3949200,3949289..3949497,3949605..3949811|
 
GCID = <gbrowseImage1>
 
name=NC_008401:3948087..3950135
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:3948087..3950135
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggccgccaccgcactccaactcccagtggccagctcgcaacgtctgacgctgaggcgtttccccggcagcggctcgttgggtcggtactctgggttgcggtggcccgtcgcggcgcaggcgaggagggcggcggaggaggggtttcgtctccgtgtcgcgttcaacccctccgggaacttcgacctctccctctccaccgaccaagacgatgccccacaagttgagcctccaccaccacctacagaaggtcgctttgagattgtcatcaacaccgatatcatccggacgctcgacctttcgcctgttcatgaagtacttggtgacttgaattccctgacaccagctcaaacaagaaatctcttggatcgaacggtcgggtttactataaactatgagagggaggatccatatgatgtgagggagctgtcagagttccctgatataaggctatggtttgtgaggcttgatgcttgttacccttggttccctgttgtgcttgattggagagctggtgaacttgccagatatgccgcaatgctggcccctcaccagatgagcatgaggcttggtgtggtcttcaacccggaggcgctggagctgtttgtgatgaagaaggtgttcattgtttactcatggctaaagcagcaggaacatcctaaacctggactcaagacggctgacatggccaggatgcttggtttcggtataggagatgaattattcgacttgattgagaagtatcctgctggtccttcatga</cdnaseq>|
 
AA = <aaseq>MAATALQLPVASSQRLTLRRFPGSGSLGRYSGLRWPVAAQARRA                    AEEGFRLRVAFNPSGNFDLSLSTDQDDAPQVEPPPPPTEGRFEIVINTDIIRTLDLSP                    VHEVLGDLNSLTPAQTRNLLDRTVGFTINYEREDPYDVRELSEFPDIRLWFVRLDACY                    PWFPVVLDWRAGELARYAAMLAPHQMSMRLGVVFNPEALELFVMKKVFIVYSWLKQQE                    HPKPGLKTADMARMLGFGIGDELFDLIEKYPAGPS</aaseq>|
 
DNA = <dnaseqindica>81..291#980..1114#1203..1411#1519..1725#gttgcgtctcccgccgcggtgacctcacctctcttcctcgccgccggcggccgcgcgtccatcgcgtcgccgtcgccgccatggccgccaccgcactccaactcccagtggccagctcgcaacgtctgacgctgaggcgtttccccggcagcggctcgttgggtcggtactctgggttgcggtggcccgtcgcggcgcaggcgaggagggcggcggaggaggggtttcgtctccgtgtcgcgttcaacccctccgggaacttcgacctctccctctccaccgaccaagacggtgagcgactaggagtaaaaactactgccaatttggaaataaatttctccatggagagcggttgaaaaccaaaattccgtattttattcagttttgtgtttgagtttgaaaactatataattttctgtagtaagacaatactactgacttgtttttttttcttccattgctaactattacagtgcaccgtcaatctgctacatatgagtatctgactgagatgattgactcttagtgaagttacatcaaccatcacagttgataaccatcgcagttgatgtgcaaattgcaagaatactaatcttgttatgactaaaacatttgagcttttcactcaatcgtttgattcagtcaaagatgttctcaaacttcaattgcatgggagggatgtggcttggaaatgcctaattaaccacagggtggttcatttatgtgaaaccctgtttattggttgctagaggttccctgaagggtaaaagttgttattatgcttgaaacaaagcaagggtggaagtgattttatttcttcatgctgggttgacctcatgttacctagtaaaatttgttacaattaaaactttatttgttgcctatcagtcgttctgtgtgtataatatgcacctgttccttgatttggtaaatccatttcttttgcttgcaaatgacaatcttcgacggcttgctgtagatgccccacaagttgagcctccaccaccacctacagaaggtcgctttgagattgtcatcaacaccgatatcatccggacgctcgacctttcgcctgttcatgaagtacttggtgacttgaattccctgacaccaggtgcgcaacaatgaaagtcatgacattgtattgtttcaacagtcaattccatgttatagttaacaagaatcttatgtgtatcattcagctcaaacaagaaatctcttggatcgaacggtcgggtttactataaactatgagagggaggatccatatgatgtgagggagctgtcagagttccctgatataaggctatggtttgtgaggcttgatgcttgttacccttggttccctgttgtgcttgattggagagctggtgaacttgccagatatgccgcaatgctggcccctcaccaggtaacaagatataacctgaattttgcatccccaaataatttggtcctacatatacttccatgtcgttttggagtttaagatgaattcatatttgcaaaaatctgcagatgagcatgaggcttggtgtggtcttcaacccggaggcgctggagctgtttgtgatgaagaaggtgttcattgtttactcatggctaaagcagcaggaacatcctaaacctggactcaagacggctgacatggccaggatgcttggtttcggtataggagatgaattattcgacttgattgagaagtatcctgctggtccttcatgaatctatctccataacctagagaattttgtcaataataggcatcacatcatacctttttcttttttttttaagcatcacccggggcgaaatgctcacctgaatatggattacatcatactgaatcaaatgataactgttttcagtcgtctgggctttgctatatgttgttgttgtctacaggaaacaattcaatgtgtaaatagtgccaaagaaatcaaattttagctcaggagtacagtttgagattttgcttctggtgctagtaactttgtaagctcctgcaactgtgatatgaatataattttgccactaacgccttgcttg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067614.1 RefSeq:Os08g0167500]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:27, 12 June 2015

The rice gene Os08g0167500 was reported as CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex, is essential for photorespiration in Orazy sativa Japonica Group.

Annotated Information

Function

 The role of NAD(P)H dehydrogenase (NDH)‐dependent cyclic electron flow around photosystem I in photosynthetic regulation and plant growth at several temperatures was examined in rice (Oryza sativa) that is defective in CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex (crr6). NdhK was not detected by Western blot analysis in crr6 mutants, resulting in lack of a transient post‐illumination increase in chlorophyll fluorescence, and confirming that crr6 mutants lack NDH activity. When plants were grown at 28 or 35°C, all examined photosynthetic parameters, including the CO2 assimilation rate and the electron transport rate around photosystems I and II, at each growth temperature at light intensities above growth light (i.e. 800 μmol photons m−2 sec−1), were similar between crr6 mutants and control plants. However, when plants were grown at 20°C, all the examined photosynthetic parameters were significantly lower in crr6 mutants than control plants, and this effect on photosynthesis caused a corresponding reduction in plant biomass. The Fv/Fm ratio was only slightly lower in crr6 mutants than in control plants after short‐term strong light treatment at 20°C. However, after long‐term acclimation to the low temperature, impairment of cyclic electron flow suppressed non‐photochemical quenching and promoted reduction of the plastoquinone pool in crr6 mutants. Taken together, our experiments show that NDH‐dependent cyclic electron flow plays a significant physiological role in rice during photosynthesis and plant growth at low temperature.

Expression

 Rice crr6 mutants do not accumulate the NDH complex. CRR6 is a stromal protein that is required for the assembly of NDH sub-complex A in Arabidopsis (Peng et al., 2010), and is encoded by a single-copy gene (Os08g0167500) in rice. The Tos17 retrotransposon was inserted into the exon of this gene (OsCRR6). Homozygous Tos17 insertion plants were identified by PCR analysis from progeny of a heterozygous plant provided by the National Institute of Agrobiological Sciences of Japan. As Tos17 mutant lines may include multiple insertions in a single genome, the crr6 mutant plant was crossed with the wild-type, and the resulting plants containing the homo-zygous wild-type CRR6 allele were used as control plants (+/+) in the experiments described below . As the control plants behaved like wild-type plants in all experi-ments, we describe differences between crr6 mutants and the control plants (+/+). The fact that the TOS17 insertioncaused the mutant phenotype was further confirmed in the generation (see below).
 Immunoblot analysis showed that CRR6 was not present in crr6 mutants (Figure 1c). The chloroplast NDH complex is divided into four parts (the A, B, membrane and lumen sub-complexes; Peng et al., 2008, 2011), and CRR6 is required for accumulation of subcomplex A in Arabidopsis (Peng et al.,2008). To study the effect of disruption of CRR6 on accumu-lation of the NDH complex in rice, we assessed the level of NdhK, a subunit of sub-complex A of the NDH complex, in crr6 mutants (Figure 1c). The NdhK level was drastically reduced to below the detection limit in crr6 mutants. Thus,consistent with observations in Arabidopsis (Peng et al.,2010), accumulation of NDH sub-complex A was impaired in rice crr6 mutants.
  • mRNA and Protein(s)

NM_001067614.1 → NP_001061079.1 Os08g0167500 [Oryza sativa Japonica Group] See proteins identical to NP_001061079.1 Status: PROVISIONAL UniProtKB/TrEMBL|Q6ZCP8 Conserved Domains (1) summary pfam08847 || DUF1817; Domain of unknown function (DUF1817)

Evolution

 Gene ID: 4344752  
 Gene symbol:Os08g0167500  
 Gene description:Os08g0167500  
 Gene type:protein coding  
 RefSeq status:PROVISIONAL  
 Organism:Oryza sativa Japonica Group (cultivar: Nipponbare)  
 Lineage:Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.

Labs working on this gene

 Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Aoba-ku, Sendai 981-8555, Japan
 Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502, Japan

References

 Wataru Yamori;Naoki Sakata;Yuji Suzuki;Toshiharu Shikanai;Amane Makino
 Cyclic electron flow around photosystem I via chloroplast NAD(P)H dehydrogenase (NDH) complex performs a significant physiological role during photosynthesis and plant growth at low temperature in rice
 The Plant Journal, 2011, 68(6): 966-976

Structured Information