Difference between revisions of "Os08g0174500"

From RiceWiki
Jump to: navigation, search
(Wild Type & Mutants)
m (Structured Information)
 
(17 intermediate revisions by 2 users not shown)
Line 7: Line 7:
 
* Grain yield, heading date, and plant height have been regarded as the three most important agronomic traits of rice regulated by many quantitative trait loci (QTLs). ''OsDTH8'' is a major QLT encoding a putative HAP3/NF-YB/CBF-A subunit of the CCAAT-box-binding transcription factor which suppress flowering by down-regulating several important floral transition activators, such as ''Ehd1'', ''Hd3a'' and ''RFT1''<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />. <br><br>
 
* Grain yield, heading date, and plant height have been regarded as the three most important agronomic traits of rice regulated by many quantitative trait loci (QTLs). ''OsDTH8'' is a major QLT encoding a putative HAP3/NF-YB/CBF-A subunit of the CCAAT-box-binding transcription factor which suppress flowering by down-regulating several important floral transition activators, such as ''Ehd1'', ''Hd3a'' and ''RFT1''<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />. <br><br>
 
* ''OsDTH8'' can also influence plant height and yield potential by the regulation of stem growth and panicle development <ref name="ref1" /><ref name="ref2" /><ref name="ref3" />. It was considerd that ''OsDTH8'' could provide a hard-won opportunity for molecular mechanism exploration of the relationship between grain yield and heading potential<ref name="ref2" />.<br><br>
 
* ''OsDTH8'' can also influence plant height and yield potential by the regulation of stem growth and panicle development <ref name="ref1" /><ref name="ref2" /><ref name="ref3" />. It was considerd that ''OsDTH8'' could provide a hard-won opportunity for molecular mechanism exploration of the relationship between grain yield and heading potential<ref name="ref2" />.<br><br>
'''GO assignment(s):''' GO:0003677, GO:0005622, GO:0005634, GO:0043565
+
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003677 GO:0003677], [http://amigo.geneontology.org/amigo/term/GO:0005622 GO:0005622], [http://amigo.geneontology.org/amigo/term/GO:0005634 GO:0005634], [http://amigo.geneontology.org/amigo/term/GO:0043565 GO:0043565]
 +
 
 
===Wild Type & Mutants===
 
===Wild Type & Mutants===
 
[[File:OsDTH8_2.jpg|left|thumb|210px|'''Figure 2.''' ''Transformants (left) VS. wild-type (right)(from reference<ref name="ref2" />).'']]
 
[[File:OsDTH8_2.jpg|left|thumb|210px|'''Figure 2.''' ''Transformants (left) VS. wild-type (right)(from reference<ref name="ref2" />).'']]
 
<br>
 
<br>
 
* The population genetics analysis made by ''Xiangjin Wei'' et al. in 2010 showed that the chromosome segment substitution lines of ''OsDTH8'' under the Asominori genetic background (''Japonica'') diplayed earlier heading than Asominori. Their plant height, number of grains per panicle, yield, and dry weight per plant decreased significantly in compared with Asominori NLD condition (Figure 1)<ref name="ref1" />.<br><br>
 
* The population genetics analysis made by ''Xiangjin Wei'' et al. in 2010 showed that the chromosome segment substitution lines of ''OsDTH8'' under the Asominori genetic background (''Japonica'') diplayed earlier heading than Asominori. Their plant height, number of grains per panicle, yield, and dry weight per plant decreased significantly in compared with Asominori NLD condition (Figure 1)<ref name="ref1" />.<br><br>
 +
* The transgenetic analysis in rice made by ''Wen-Hao Yan'' et al. showed that the positive T1 plants of ''OsDTH8'' could produce more grains. They displayed significantly delayed heading with taller culms compared to the transgenic negative plants. On the whole, a positive T1 plant resulted in an increases 60% in grain yield per plant and grains per panicle compared to the control group<ref name="ref2" />.<br><br>
 +
* The transgenetic analysis in Arabidopsis by ''Wen-Hao Yan'' et al. showed that transformants of ''OsDTH8'' can bloom about 10 days earlier than the wild-type under LD conditions, however, no obvious difference was observed between the transformants and wild-type under SD conditions (Figure 2)<ref name="ref2" />.<br><br><br>
 +
[[File:OsDTH8_3.jpg|right|thumb|300px|'''Figure 3.''' ''The expression pattern of OsDTH8 (L/leaves, S/leaf sheaths, C/culms, P/young panicles, R/roots) (from reference<ref name="ref1" />).'']]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The expression pattern analysis made by ''Xiangjin Wei'' et al. showed that ''OsDTH8'' was expressed in leaves, leaf sheaths, culms, young panicles and roots. However, its expression levels were higher in roots, young panicles, and leaves than those in leaf sheaths and culms (Figure 3)<ref name="ref1" />.
  
===Evolution===
+
* ''OsDTH8'' could negatively influence the expression of ''Ehd1'', ''Hd3a'' and ''RFT1'' but not ''Hd1'' and ''Ghd7''<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />.
Please input evolution information here.
+
===Subcellular Localization ===
 
+
* The subcellular localization analysis made by ''Xiangjin Wei'' et al. suggests that ''OsDTH8'' is a nuclear protein<ref name="ref1" />.
You can also add sub-section(s) at will.
+
<br>
 +
===Gene Structure===
 +
[[File:OsDTH8_4.png|center|thumb|727px|'''Figure 4.''' ''Structure of OsDTH (from NCBI BLASTP).'']]
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* State Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Provincial Center of Plant Gene Engineering, Nanjing Agricultural University, Nanjing 210095, China;
 +
* Chinese National Center for Rice Improvement, China National Rice Research Institute, Hangzhou 310006, China;
 +
* Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 100081, China;
 +
* National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan;
 +
* State Key Laboratory of Plant Physiology and Biochemistry, National Evaluation Centre for Agricultural Wild Plants (Rice), Laboratory of Crop Heterosis and Utilization of the Ministry of Education, Beijing 100193, China;
 +
* Beijing Key Laboratory of Crop Genetic Improvement, Department of Plant Genetics and Breeding, China Agricultural University, Beijing 100193, China.
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Wei X, Xu J, Guo H, et al. DTH8 suppresses flowering in rice, influencing plant height and yield potential simultaneously[J]. Plant Physiology, 2010, 153(4): 1747-1758.
 +
</ref>
 +
* <ref name="ref2">
 +
Yan W H, Wang P, Chen H X, et al. A major QTL, Ghd8, plays pleiotropic roles in regulating grain productivity, plant height, and heading date in rice[J]. Molecular Plant, 2011, 4(2): 319-330.
 +
</ref>
 +
* <ref name="ref3">
 +
Dai X, Ding Y, Tan L, et al. LHD1, an Allele of DTH8/Ghd8, Controls Late Heading Date in Common Wild Rice (Oryza rufipogon) F[J]. Journal of Integrative Plant Biology, 2012, 54(10): 790-799.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os08g0174500|
 
Description = Similar to HAP3|
 
Version = NM_001067642.1 GI:115475020 GeneID:4344784|
 
Length = 1640 bp|
 
Definition = Oryza sativa Japonica Group Os08g0174500, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:4332728..4334367|
 
CDS = 4332849..4333742|
 
GCID = <gbrowseImage1>
 
name=NC_008401:4332728..4334367
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:4332728..4334367
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaagagtaggaagagctatgggcacttgctgagcccggtgggcagcccgccgttggacaacgagtccggcgaggcggcggcggcggctgcggctggcggcggcggctgcgggagcagcgccgggtatgtcgtctacggcggcggcggcggtggggactcgccggcgaaggagcaggacaggttcctgccgatcgcgaacgtgagccgcatcatgaagcggtcgctgccggcgaacgccaagatctccaaggagtcgaaggagacggtgcaggagtgcgtgtcggagttcatcagcttcgttacaggcgaggcctccgacaagtgccagcgcgagaagcggaagaccatcaacggcgacgacctcctctgggccatgaccacgctggggttcgaggcctacgtcggcccgctcaagtcctacctcaaccgctaccgcgaggccgagggcgagaaggccgacgtgctcggcggcgccggcggcgccgccgcggcgcgccacggcgagggcggttgctgcggcggcggcggcggcggcgccgatggcgtcgtcatcgacgggcattacccgctcgccggcggcctgtcacactcacaccatggtcatcagcagcaggacggcggcggcgacgtcgggctcatgatgggcggcggcgacgccggcgtcgggtacaacgccggggccgggtcgacgacgacggcgttctacgcgccggcggcgacggcggcgtcagggaacaaggcgtactgcggcggcgacgggtcgagggtgatggagttcgagggcatcggcggcgaggaggagagcggaggcggcggcggcggcggcgagagggggttcgccggccacctccatggcgtgcaatggtttagactaaagaggaatactaattag</cdnaseq>|
 
AA = <aaseq>MKSRKSYGHLLSPVGSPPLDNESGEAAAAAAAGGGGCGSSAGYV                    VYGGGGGGDSPAKEQDRFLPIANVSRIMKRSLPANAKISKESKETVQECVSEFISFVT                    GEASDKCQREKRKTINGDDLLWAMTTLGFEAYVGPLKSYLNRYREAEGEKADVLGGAG                    GAAAARHGEGGCCGGGGGGADGVVIDGHYPLAGGLSHSHHGHQQQDGGGDVGLMMGGG                    DAGVGYNAGAGSTTTAFYAPAATAASGNKAYCGGDGSRVMEFEGIGGEEESGGGGGGG                    ERGFAGHLHGVQWFRLKRNTN</aaseq>|
 
DNA = <dnaseqindica>626..1519#tcggtcattagtatatgttagtataaattaaataattaaacaccttaaacaatattttttcgtcgtagtttgatcatcacctaagattttttagtcttttcaaaatgatcatcagctaacaagtgtatctttatttatttgtgcaagaagtaaatgagcatcattgaatgcgctgcacacatgtaatgcaaacaaccaagttaatttttattggtgcaacggcgcgcactatttaaaacgtgacgcaatgcagcgatagagcaccttgatagataagaattaatttcagcatgatgtagattttgttatccttaatctctactcactttgcataggtaataaattaaaccgctgaactattactacatggtttacatgaaaggtgatcgggtagggacgagaatgtcgcgacacacataatatatatagtagcgtccttatgtttgctttgtgtccgcatcgataccgtcttcccactcgcatctcctcacctcctttccttctttaaaaggagagcatcaccactccatcctcaactcccataacctcccccttctctctctctctaactacacactctctctctagctagctagctagctatagctagtgttgttagcttcacatgaagagtaggaagagctatgggcacttgctgagcccggtgggcagcccgccgttggacaacgagtccggcgaggcggcggcggcggctgcggctggcggcggcggctgcgggagcagcgccgggtatgtcgtctacggcggcggcggcggtggggactcgccggcgaaggagcaggacaggttcctgccgatcgcgaacgtgagccgcatcatgaagcggtcgctgccggcgaacgccaagatctccaaggagtcgaaggagacggtgcaggagtgcgtgtcggagttcatcagcttcgttacaggcgaggcctccgacaagtgccagcgcgagaagcggaagaccatcaacggcgacgacctcctctgggccatgaccacgctggggttcgaggcctacgtcggcccgctcaagtcctacctcaaccgctaccgcgaggccgagggcgagaaggccgacgtgctcggcggcgccggcggcgccgccgcggcgcgccacggcgagggcggttgctgcggcggcggcggcggcggcgccgatggcgtcgtcatcgacgggcattacccgctcgccggcggcctgtcacactcacaccatggtcatcagcagcaggacggcggcggcgacgtcgggctcatgatgggcggcggcgacgccggcgtcgggtacaacgccggggccgggtcgacgacgacggcgttctacgcgccggcggcgacggcggcgtcagggaacaaggcgtactgcggcggcgacgggtcgagggtgatggagttcgagggcatcggcggcgaggaggagagcggaggcggcggcggcggcggcgagagggggttcgccggccacctccatggcgtgcaatggtttagactaaagaggaatactaattagctagctaggcacacgcgtagttttattattacttaattaccgcgttaattaattgttgatgctgatgctgtttaaaattgattctccttttgcatgaaatgtttgatggtatggtttaaaa</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067642.1 RefSeq:Os08g0174500]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:28, 12 June 2015

The rice Os08g0174500 is a major QTL located at chromosome 8 of rice with pleiotropic effects on grain yield, heading date, and plant height[1][2][3]. It was reported as DTH8, Ghd8 and LHD1 in 2010, 2011 and 2012, espectively[1][2][3].

Annotated Information

Figure 1. Phenotypes of Asominori and chromosome segment substitution line of OsDTH8(CSSL61). The left is Asominori and right is CSSL61 (from reference[1]).

Function

  • Grain yield, heading date, and plant height have been regarded as the three most important agronomic traits of rice regulated by many quantitative trait loci (QTLs). OsDTH8 is a major QLT encoding a putative HAP3/NF-YB/CBF-A subunit of the CCAAT-box-binding transcription factor which suppress flowering by down-regulating several important floral transition activators, such as Ehd1, Hd3a and RFT1[1][2][3].

  • OsDTH8 can also influence plant height and yield potential by the regulation of stem growth and panicle development [1][2][3]. It was considerd that OsDTH8 could provide a hard-won opportunity for molecular mechanism exploration of the relationship between grain yield and heading potential[2].

GO assignment(s): GO:0003677, GO:0005622, GO:0005634, GO:0043565

Wild Type & Mutants

Figure 2. Transformants (left) VS. wild-type (right)(from reference[2]).


  • The population genetics analysis made by Xiangjin Wei et al. in 2010 showed that the chromosome segment substitution lines of OsDTH8 under the Asominori genetic background (Japonica) diplayed earlier heading than Asominori. Their plant height, number of grains per panicle, yield, and dry weight per plant decreased significantly in compared with Asominori NLD condition (Figure 1)[1].

  • The transgenetic analysis in rice made by Wen-Hao Yan et al. showed that the positive T1 plants of OsDTH8 could produce more grains. They displayed significantly delayed heading with taller culms compared to the transgenic negative plants. On the whole, a positive T1 plant resulted in an increases 60% in grain yield per plant and grains per panicle compared to the control group[2].

  • The transgenetic analysis in Arabidopsis by Wen-Hao Yan et al. showed that transformants of OsDTH8 can bloom about 10 days earlier than the wild-type under LD conditions, however, no obvious difference was observed between the transformants and wild-type under SD conditions (Figure 2)[2].


Figure 3. The expression pattern of OsDTH8 (L/leaves, S/leaf sheaths, C/culms, P/young panicles, R/roots) (from reference[1]).

Expression

  • The expression pattern analysis made by Xiangjin Wei et al. showed that OsDTH8 was expressed in leaves, leaf sheaths, culms, young panicles and roots. However, its expression levels were higher in roots, young panicles, and leaves than those in leaf sheaths and culms (Figure 3)[1].
  • OsDTH8 could negatively influence the expression of Ehd1, Hd3a and RFT1 but not Hd1 and Ghd7[1][2][3].

Subcellular Localization

  • The subcellular localization analysis made by Xiangjin Wei et al. suggests that OsDTH8 is a nuclear protein[1].


Gene Structure

Figure 4. Structure of OsDTH (from NCBI BLASTP).

Labs working on this gene

  • State Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Provincial Center of Plant Gene Engineering, Nanjing Agricultural University, Nanjing 210095, China;
  • Chinese National Center for Rice Improvement, China National Rice Research Institute, Hangzhou 310006, China;
  • Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 100081, China;
  • National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan;
  • State Key Laboratory of Plant Physiology and Biochemistry, National Evaluation Centre for Agricultural Wild Plants (Rice), Laboratory of Crop Heterosis and Utilization of the Ministry of Education, Beijing 100193, China;
  • Beijing Key Laboratory of Crop Genetic Improvement, Department of Plant Genetics and Breeding, China Agricultural University, Beijing 100193, China.

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Wei X, Xu J, Guo H, et al. DTH8 suppresses flowering in rice, influencing plant height and yield potential simultaneously[J]. Plant Physiology, 2010, 153(4): 1747-1758.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 Yan W H, Wang P, Chen H X, et al. A major QTL, Ghd8, plays pleiotropic roles in regulating grain productivity, plant height, and heading date in rice[J]. Molecular Plant, 2011, 4(2): 319-330.
  3. 3.0 3.1 3.2 3.3 3.4 Dai X, Ding Y, Tan L, et al. LHD1, an Allele of DTH8/Ghd8, Controls Late Heading Date in Common Wild Rice (Oryza rufipogon) F[J]. Journal of Integrative Plant Biology, 2012, 54(10): 790-799.

Structured Information