Difference between revisions of "Os08g0441100"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os08g0441100| Description = Similar to PnC401 homologue| Version = NM_001068442.1 GI:115476621 GeneID:4345687| Length = 1141 bp| Definition = O...")
 
(Structured Information)
 
(3 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
'''''OsCIPK06''''' is a member of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases) in rice<ref name="ref1"/>.
GeneName = Os08g0441100|
+
 
Description = Similar to PnC401 homologue|
+
==Annotated Information==
Version = NM_001068442.1 GI:115476621 GeneID:4345687|
+
===Function===
Length = 1141 bp|
+
*''OsCIPK06'' contains '''at least one of the three cis-elements''' in the promoter regions<ref name="ref1"/>. 
Definition = Oryza sativa Japonica Group Os08g0441100, complete gene.|
+
 
Source = Oryza sativa Japonica Group
+
*''OsCIPK6'':''OsCIPK27'' is duplicated genes<ref name="ref2"/>.
 +
<br>
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0007165 GO:0007165]
 +
 
 +
===Expression===
 +
*''OsCIPK6'' is commonly '''up-regulated''' in the '''salt and drought stresses'''<ref name="ref2"/>. ''OsCIPK06'' and ''OsCIPK16'', and not ''OsCIPK27'', in subgroup II showed '''up-regulation''' in response to '''drought stress'''<ref name="ref3"/>.
 +
 
 +
*''OsCIPK06'' showed preferred expression in most reproductive tissues/organs except for the stigma/ovary. In addition, this gene showed predominant expression in vegetative tissues/organs of indica samples compared to ''OsCIPK16'' and ''OsCIPK27''<ref name="ref3"/>.
 +
 
 +
===Evolution===
 +
''OsCIPK06'' belongs to '''subgroup II''' of ''OsCIPK'' family<ref name="ref3"/>.
 +
 
 +
===Knowledge Extension===
 +
[[File: OsCIPK family Functional.png|right|thumb|260px|'''Figure 1.''' ''Functional gene network analysis of OsCIPK family members.(from reference <ref name="ref3"/>).'']] 
 +
*From real-time RT-PCR analyses, ''Giong et al.'' identified 16 OsCIPK genes showing a significant up- or down-regulation in response to '''drought stress'''. Using the probable functional gene network tool, RiceNet, ''Giong et al.'' generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 1)<ref name="ref3"/>.
 +
*More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 1) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 1) under drought stress to all the elements in this network<ref name="ref3"/>.
 +
*Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)<ref name="ref3"/>.
 +
 
 +
*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli<ref name="ref4"/>. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref4"/>.
 +
 
 +
 
 +
 
 +
==Labs working on this gene==
 +
*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
 +
*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
 +
*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
 +
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, Dhaula Kuan, New Delhi-110021, India
 +
 
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
 +
</ref>
 +
* <ref name="ref2">
 +
Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
 +
</ref>
 +
* <ref name="ref3">
 +
Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
 +
</ref>
 +
* <ref name="ref4">
 +
Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:21555459..21556599|
 
CDS = 21555461..21556375|
 
GCID = <gbrowseImage1>
 
name=NC_008401:21555459..21556599
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:21555459..21556599
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>aagccggagaacctgctgctcgacgaggccgggaacctcaaggtggtcgacttcggcctcagcgcgctcgccgaccacgcccgcgccgacggcctcctccacacgctctgcggcacgccggggtacgccgcgcccgaggtgctccgcgacaagggctacgacggcgccaaggccgacctctggtcctgcggcgtcatcctctacgtgctcctcgccgggtccctcccgttccccgacgacaacatcgtcaccctgtaccggaaggcccagcgcggcgactaccggtgcccggcgtggctgtccaccgacgcgcgccgcctcatccccaggctgctcgaccccaacccgaccacccgcatcagcgtcgcgcagctcgtcgagacgccgtggttcaagaagacgtccatctccaggcctgtgagcatagagcttcctccggcctttgccgatcctgctccggctaaggaggaggccgagaaggacgagccggagacgctgaacgcgttccacctgatatcactctcggaggggttcgacctctcgccgctgttcgagggggactcggccaaggggaggcgggacggtggcatgctgttcgcgacgcgggagccagcgagcggcgtgatctcccgcctcgagggggtggcggcgcgcggcggcggccggatgcgggtgaccaagagcggcgcccgcggcgtgcgcctggagggcgcggagcgcggcggggccaagggccgcctcgccgtggccgccgacatcttcagcgtggcgccctccgtcctcgtcgtcgacgtcaagaaggacggcggcgacacgctcgagtaccgctcattctgcagcgaggagctccggccggcgctccaggacatcgtctggggcgccgccgccgacccaacgccgaccgccgccgtctga</cdnaseq>|
 
AA = <aaseq>KPENLLLDEAGNLKVVDFGLSALADHARADGLLHTLCGTPGYAA                    PEVLRDKGYDGAKADLWSCGVILYVLLAGSLPFPDDNIVTLYRKAQRGDYRCPAWLST                    DARRLIPRLLDPNPTTRISVAQLVETPWFKKTSISRPVSIELPPAFADPAPAKEEAEK                    DEPETLNAFHLISLSEGFDLSPLFEGDSAKGRRDGGMLFATREPASGVISRLEGVAAR                    GGGRMRVTKSGARGVRLEGAERGGAKGRLAVAADIFSVAPSVLVVDVKKDGGDTLEYR                    SFCSEELRPALQDIVWGAAADPTPTAAV</aaseq>|
 
DNA = <dnaseqindica>3..917#tcaagccggagaacctgctgctcgacgaggccgggaacctcaaggtggtcgacttcggcctcagcgcgctcgccgaccacgcccgcgccgacggcctcctccacacgctctgcggcacgccggggtacgccgcgcccgaggtgctccgcgacaagggctacgacggcgccaaggccgacctctggtcctgcggcgtcatcctctacgtgctcctcgccgggtccctcccgttccccgacgacaacatcgtcaccctgtaccggaaggcccagcgcggcgactaccggtgcccggcgtggctgtccaccgacgcgcgccgcctcatccccaggctgctcgaccccaacccgaccacccgcatcagcgtcgcgcagctcgtcgagacgccgtggttcaagaagacgtccatctccaggcctgtgagcatagagcttcctccggcctttgccgatcctgctccggctaaggaggaggccgagaaggacgagccggagacgctgaacgcgttccacctgatatcactctcggaggggttcgacctctcgccgctgttcgagggggactcggccaaggggaggcgggacggtggcatgctgttcgcgacgcgggagccagcgagcggcgtgatctcccgcctcgagggggtggcggcgcgcggcggcggccggatgcgggtgaccaagagcggcgcccgcggcgtgcgcctggagggcgcggagcgcggcggggccaagggccgcctcgccgtggccgccgacatcttcagcgtggcgccctccgtcctcgtcgtcgacgtcaagaaggacggcggcgacacgctcgagtaccgctcattctgcagcgaggagctccggccggcgctccaggacatcgtctggggcgccgccgccgacccaacgccgaccgccgccgtctgatgccaccattgttagcgtccaaagtcattgtgtcacagtagccgatgctgttcttcctcctcctgtgcttgattcgatagcgacgtgcatgaactagtatcgctgtttgggtggtgggggcagttggcaagaacaaatctgtatctctgcctcaaaagcaacagcatttttttttcttttgcacaagttgcaattgtttttgtgatggtctttgcttacatctg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001068442.1 RefSeq:Os08g0441100]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:31, 12 June 2015

OsCIPK06 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases) in rice[1].

Annotated Information

Function

  • OsCIPK06 contains at least one of the three cis-elements in the promoter regions[1].
  • OsCIPK6:OsCIPK27 is duplicated genes[2].


GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165

Expression

  • OsCIPK6 is commonly up-regulated in the salt and drought stresses[2]. OsCIPK06 and OsCIPK16, and not OsCIPK27, in subgroup II showed up-regulation in response to drought stress[3].
  • OsCIPK06 showed preferred expression in most reproductive tissues/organs except for the stigma/ovary. In addition, this gene showed predominant expression in vegetative tissues/organs of indica samples compared to OsCIPK16 and OsCIPK27[3].

Evolution

OsCIPK06 belongs to subgroup II of OsCIPK family[3].

Knowledge Extension

Figure 1. Functional gene network analysis of OsCIPK family members.(from reference [3]).
  • From real-time RT-PCR analyses, Giong et al. identified 16 OsCIPK genes showing a significant up- or down-regulation in response to drought stress. Using the probable functional gene network tool, RiceNet, Giong et al. generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 1)[3].
  • More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 1) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 1) under drought stress to all the elements in this network[3].
  • Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 1)[3].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli[4]. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[4].


Labs working on this gene

  • National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
  • Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, Dhaula Kuan, New Delhi-110021, India

References

  1. 1.0 1.1 Xiang Y, Huang Y, Xiong L. Characterization of stress-responsive CIPK genes in rice for stress tolerance improvement[J]. Plant physiology, 2007, 144(3): 1416-1428.
  2. 2.0 2.1 Kanwar P, Sanyal S K, Tokas I, et al. Comprehensive structural, interaction and expression analysis of CBL and CIPK complement during abiotic stresses and development in rice[J]. Cell Calcium, 2014.
  3. 3.0 3.1 3.2 3.3 3.4 3.5 3.6 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  4. 4.0 4.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.

Structured Information