Difference between revisions of "Os08g0504700"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os08g0504700| Description = Similar to Multiple stress-responsive zinc-finger protein ISAP1 (Stress- associated protein 1) (OsISAP1)| Version = N...")
 
(Structured Information)
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
{{JaponicaGene|
+
'''''OsSAP11''''' confers abiotic stress tolerance in rice<ref name="ref1"/>.
GeneName = Os08g0504700|
+
==Annotated Information==
Description = Similar to Multiple stress-responsive zinc-finger protein ISAP1 (Stress- associated protein 1) (OsISAP1)|
+
===Function===
Version = NM_001068716.1 GI:115477169 GeneID:4345973|
+
[[File: OsSAP11 Cloning1.jpg|left|thumb|300px|'''Figure 1.''' ''Cloning and overexpression of OsSAP11 and OsRLCK253 genes in Arabidopsis plants.(from reference <ref name="ref1"/>).'']]
Length = 983 bp|
+
*Open reading frames (ORFs) of ''OsSAP1/11'' and ''OsRLCK253'' were '''cloned in''' pSITE-3CA/1CA binary vectors, as YFP/CFP fusion proteins(Figure 1). ''OsSAP1/11'' showed '''interactions with self''' as well as each other '''through A20 domain'''. Although AN1 also interacted with the A20 domain, no clear interaction of AN1 with ''OsSAP1/11'' was observed<ref name="ref1"/>.
Definition = Oryza sativa Japonica Group Os08g0504700, complete gene.|
+
 
Source = Oryza sativa Japonica Group
+
*Both ''OsSAP11'' and ''OsRLCK253'' could '''improve the water-deficit''' and '''salt stress tolerance''' in transgenic ''Arabidopsis'' plants via a '''signaling pathway''' affecting the expression of '''several common endogenous genes'''. ''OsSAP11'' and ''OsRLCK253'' in conferring abiotic stress tolerance. Both ''OsSAP11'' and ''OsRLCK253'' not only '''improved plant survival''' under stress but also '''protected against loss in yield''' caused by '''salt stress'''<ref name="ref1"/>.
 +
 
 +
*Alternatively, ''OsRLCK253'' may '''activate OsSAP1/11 protein''', which, on activation, may '''degrade''' or '''alter''' the '''activity of negative regulator''' of plant abiotic stress tolerance. In ''OsSAP11'' plants, the '''entire pathway for GA biosynthesis''' was also '''activated'''<ref name="ref1"/>.
 +
 
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003677 GO:0003677],[http://amigo.geneontology.org/amigo/term/GO:0008270 GO:0008270]
 +
 
 +
===Mutation===
 +
[[File: OsSAP11 transgenic1.jpg|right|thumb|300px|'''Figure 2.''' ''Five-wk-old transgenic and wild-type (WT) plants.(from reference <ref name="ref1"/>).'']]
 +
Transgenic and wild-type plants<ref name="ref1"/>: 
 +
*Taking the '''radicle emergence''' as a '''parameter''' for '''seed germination''', almost all the seeds germinated on day 5 in ''OsSAP11'' transgenic lines, while only ''c.'' 80% of wild-type (WT) seeds showed germination.
 +
*However, transgenics '''fared better''' with 50–70% and 50–85% '''survival''' in ''OsSAP11'' and ''OsRLCK253'' plants, respectively, in comparison with 20–25% survival of WT plants. The effect on yield was also tested in these plants following the recovery after '''salt stress'''.
 +
*At the end of stress period(18% '''soil moisture'''), '''RWC''' in WT '''leaves''' was '''reduced''' to 43% while it varied between 58%–64% in ''OsRLCK253'' and 56%–68% in ''OsSAP11'' expressing transgenics, pointing towards the '''better water retention capacity''' in transgenics compared with WT under water-deficit stress.
 +
*The ''OsSAP11'' and ''OsRLCK253'' expressers showed ''c.'' 6–20% and 10–22% '''higher seed weight''' per plant, respectively, over WT after '''water-deficit stress'''.
 +
*The '''growth''' of transgenic lines and '''seed production''' in unstressed conditions was similar to WT plants (Fig. 2), indicating no '''negative effects''' of transgenes overexpression.
 +
 
 +
===Expression===
 +
*There were only '''six SAP genes''' (''OsSAP1'', ''OsSAP9'', ''OsSAP11'', ''OsSAP12'', ''OsSAP14'' and ''OsSAP17''), which showed '''significant increase''' in expression upon exposure to '''cold stress'''<ref name="ref2"/>.
 +
 
 +
*It was interesting to see that '''two rice gene pairs'' (''OsSAP1''–''OsSAP11'' and ''OsSAP6''–''OsSAP9'') present in '''duplicated segments''' were significantly '''similar in their expression pattern'''<ref name="ref2"/>.
 +
 
 +
*''OsSAP11'' and ''OsRLCK253'' also showed '''responsiveness to salt and water-deficit stress'''. Overexpression of both ''OsSAP11'' and ''OsRLCK253'' in ''Arabidopsis'' could '''enhance''' the '''water-deficit''' and '''salt stress tolerance'''<ref name="ref1"/>.
 +
 
 +
*In ''OsSAP11'' expressing plants, '''633 genes''' showed '''change''' in their expression level, of which '''231''' were '''upregulated''' and '''402''' were '''downregulated'''. Out of 633 genes affected in ''OsSAP11'' plants, '''143  genes''' could be '''assigned functions''' in '''different metabolic pathways'''. In ''OsSAP11'' plants, genes involved in '''all the steps''' of '''GA biosynthesis''' were '''upregulated'''<ref name="ref1"/>.
 +
 
 +
===Subcellular localization===
 +
''OsSAP11'' showed localization in the '''nucleus''' in addition to the '''cytoplasm''' and '''plasma membrane'''. It is
 +
worth noting that ''OsSAP1'' and ''OsSAP11'' show '''differential interactions with ''OsRLCK253''''', possibly because of subtle differences in their subcellular localizations<ref name="ref1"/>.
 +
 
 +
===Evolution===
 +
It was found that the A20 domain mediates the interaction of ''OsSAP1'' with self, its '''close homolog OsSAP11''' and a rice receptor-like cytoplasmic kinase, ''OsRLCK253''<ref name="ref1"/>.
 +
 
 +
===Knowledge Extension===
 +
*In the recent past, a new family of genes termed as '''SAP(Stress Associated protein)''' gene family was studied in rice for its role in abiotic stress conditions by expression profiling under those conditions<ref name="ref2"/>. SAP gene family members are characterized by the presence of A20/AN1 domain in their putative encoded proteins. The majority was found to have both the A20 zinc-finger domain (present at the N-terminus) and the AN1 zinc-finger domain (present at the C-terminus). This is consistent with the previous finding from animal systems that the A20 and AN1 zinc-finger domains are usually found associated with each other<ref name="ref3"/>.
 +
 
 +
*All the members of the rice SAP genenfamily present in the rice genome showed inducibility to one or the other abiotic stresses. SAP gene family members, as in the case of animal systems may be involved in downregulating the pathway associated with abiotic stress injuries such as cell death by ubiquitinylating the key proteins and hence targeting them to degradation<ref name="ref2"/>. It would be important to define the relative function of the members of this gene family in the life of the rice plant<ref name="ref2"/><ref name="ref3"/>.
 +
 
 +
*Based on the phylogenetic analysis of the AN1 zincfinger domains, ''Jin et al.''<ref name="ref4"/> recently divided all A20/AN1 zincfinger-containing SAP genes into two groups: Type I and Type II. Type I genes contain the traditional pattern of cysteine- and histidine-rich motifs, whereas Type II SAP genes contain the expanded domain CX4CX2CX9-12CX1-2CX4CX2HX5HXC where X represents any amino acid. Most Type I genes lack introns and contain one intact A20 type domain and/or one AN1 type zincfinger domain; most Type II genes have a single intron but do not contain an A20 domain<ref name="ref4"/><ref name="ref5"/>.
 +
 
 +
==Labs working on this gene==
 +
*Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110021, India
 +
*National Institute of Plant Genome Research, Aruna Asaf Ali Road, New Delhi 110067, India
 +
 
 +
==References==
 +
<references>
 +
* <ref name="ref1">
 +
Giri J, Vij S, Dansana P K, et al. Rice A20/AN1 zinc‐finger containing stress‐associated proteins (SAP1/11) and a receptor‐like cytoplasmic kinase (OsRLCK253) interact via A20 zinc‐finger and confer abiotic stress tolerance in transgenic Arabidopsis plants[J]. New Phytologist, 2011, 191(3): 721-732.
 +
</ref>
 +
* <ref name="ref2">
 +
Vij S, Tyagi A K. Genome-wide analysis of the stress associated protein (SAP) gene family containing A20/AN1 zinc-finger (s) in rice and their phylogenetic relationship with Arabidopsis[J]. Molecular Genetics and Genomics, 2006, 276(6): 565-575.
 +
</ref>
 +
* <ref name="ref3">
 +
Evans P, Ovaa H, Hamon M, et al. Zinc-finger protein A20, a regulator of inflammation and cell survival, has de-ubiquitinating activity[J]. Biochem. J, 2004, 378: 727-734.
 +
</ref>
 +
* <ref name="ref4">
 +
Jin Y, Wang M, Fu J, et al. Phylogenetic and expression analysis of ZnF-AN1 genes in plants[J]. Genomics, 2007, 90(2): 265-275.
 +
</ref>
 +
* <ref name="ref5">
 +
Saad R B, Zouari N, Ramdhan W B, et al. Improved drought and salt stress tolerance in transgenic tobacco overexpressing a novel A20/AN1 zinc-finger “AlSAP” gene isolated from the halophyte grass Aeluropus littoralis[J]. Plant molecular biology, 2010, 72(1-2): 171-190.  
 +
</ref>
 +
</references>
 +
 
 +
==Structured Information==
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
 
AP = Chromosome 8:25041942..25042924|
 
CDS = 25042010..25042522|
 
GCID = <gbrowseImage1>
 
name=NC_008401:25041942..25042924
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008401:25041942..25042924
 
source=RiceChromosome08
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgcagagggagaagaaggtggaggagccgacggagctgagggcgccggagatgacgctctgcgccaacagctgcgggttcccgggcaacccggcgaccaacaacctctgccagaactgcttcttggctgcctcggcgtcttcttcttcttcttccgccgctgcctcgccgtcgacgacgtcgttgccggtgtttccggtggtggagaagccgaggcaggccgtacagtcgtcggcggcggcggcggtggcgctggtggttgagcggccgacggcggggccggtggagtcgtcgtcgaaggcgtcgaggtcgtcgtcggtcaaccgatgccacagctgccggaggcgggtgggcctgaccgggttccggtgccgctgcggcgagctctactgcggcgcgcaccggtactccgaccgccacgactgcagcttcgactacaagtcggcggcgagggacgccatcgccagggagaaccccgtcgtccgcgccgccaagatcgttaggttctaa</cdnaseq>|
 
AA = <aaseq>MAQREKKVEEPTELRAPEMTLCANSCGFPGNPATNNLCQNCFLA                    ASASSSSSSAAASPSTTSLPVFPVVEKPRQAVQSSAAAAVALVVERPTAGPVESSSKA                    SRSSSVNRCHSCRRRVGLTGFRCRCGELYCGAHRYSDRHDCSFDYKSAARDAIARENP                    VVRAAKIVRF</aaseq>|
 
DNA = <dnaseqindica>69..581#gcctcgctaacccattcccaaaagcaaagcgaacctaagctcgcttcgtctctctctcggattcgatcatggcgcagagggagaagaaggtggaggagccgacggagctgagggcgccggagatgacgctctgcgccaacagctgcgggttcccgggcaacccggcgaccaacaacctctgccagaactgcttcttggctgcctcggcgtcttcttcttcttcttccgccgctgcctcgccgtcgacgacgtcgttgccggtgtttccggtggtggagaagccgaggcaggccgtacagtcgtcggcggcggcggcggtggcgctggtggttgagcggccgacggcggggccggtggagtcgtcgtcgaaggcgtcgaggtcgtcgtcggtcaaccgatgccacagctgccggaggcgggtgggcctgaccgggttccggtgccgctgcggcgagctctactgcggcgcgcaccggtactccgaccgccacgactgcagcttcgactacaagtcggcggcgagggacgccatcgccagggagaaccccgtcgtccgcgccgccaagatcgttaggttctaaaaggataatacaaggggaaaccaacctgaattttcctccttttttctttcttttttcttcttctttccttttaaaaattaaagttgagggtattattttttcttttcctgagagcttcttaaaggtgaaaggggaaaaaaaagaaagaaaaagaaaaggagatgagatgggtgactcaagatgcatcaagcaaaggaagaacaatatgatgatgatgatgttgttgttgtagtggtggttgaggttggaagttggatggaaagagggaggaaggaagaagatggggttgttgtgttgtcctcccacaaatctctatttaattttaattcccttttgtataaaatttattattatctgtggagagcattattatcagcttgagctagtggcatctttcttttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001068716.1 RefSeq:Os08g0504700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:32, 12 June 2015

OsSAP11 confers abiotic stress tolerance in rice[1].

Annotated Information

Function

Figure 1. Cloning and overexpression of OsSAP11 and OsRLCK253 genes in Arabidopsis plants.(from reference [1]).
  • Open reading frames (ORFs) of OsSAP1/11 and OsRLCK253 were cloned in pSITE-3CA/1CA binary vectors, as YFP/CFP fusion proteins(Figure 1). OsSAP1/11 showed interactions with self as well as each other through A20 domain. Although AN1 also interacted with the A20 domain, no clear interaction of AN1 with OsSAP1/11 was observed[1].
  • Both OsSAP11 and OsRLCK253 could improve the water-deficit and salt stress tolerance in transgenic Arabidopsis plants via a signaling pathway affecting the expression of several common endogenous genes. OsSAP11 and OsRLCK253 in conferring abiotic stress tolerance. Both OsSAP11 and OsRLCK253 not only improved plant survival under stress but also protected against loss in yield caused by salt stress[1].
  • Alternatively, OsRLCK253 may activate OsSAP1/11 protein, which, on activation, may degrade or alter the activity of negative regulator of plant abiotic stress tolerance. In OsSAP11 plants, the entire pathway for GA biosynthesis was also activated[1].


GO assignment(s): GO:0003677,GO:0008270

Mutation

Figure 2. Five-wk-old transgenic and wild-type (WT) plants.(from reference [1]).

Transgenic and wild-type plants[1]:

  • Taking the radicle emergence as a parameter for seed germination, almost all the seeds germinated on day 5 in OsSAP11 transgenic lines, while only c. 80% of wild-type (WT) seeds showed germination.
  • However, transgenics fared better with 50–70% and 50–85% survival in OsSAP11 and OsRLCK253 plants, respectively, in comparison with 20–25% survival of WT plants. The effect on yield was also tested in these plants following the recovery after salt stress.
  • At the end of stress period(18% soil moisture), RWC in WT leaves was reduced to 43% while it varied between 58%–64% in OsRLCK253 and 56%–68% in OsSAP11 expressing transgenics, pointing towards the better water retention capacity in transgenics compared with WT under water-deficit stress.
  • The OsSAP11 and OsRLCK253 expressers showed c. 6–20% and 10–22% higher seed weight per plant, respectively, over WT after water-deficit stress.
  • The growth of transgenic lines and seed production in unstressed conditions was similar to WT plants (Fig. 2), indicating no negative effects of transgenes overexpression.

Expression

  • There were only six SAP genes (OsSAP1, OsSAP9, OsSAP11, OsSAP12, OsSAP14 and OsSAP17), which showed significant increase in expression upon exposure to cold stress[2].
  • It was interesting to see that two rice gene pairs (OsSAP1OsSAP11 and OsSAP6OsSAP9) present in duplicated segments' were significantly similar in their expression pattern[2].
  • OsSAP11 and OsRLCK253 also showed responsiveness to salt and water-deficit stress. Overexpression of both OsSAP11 and OsRLCK253 in Arabidopsis could enhance the water-deficit and salt stress tolerance[1].
  • In OsSAP11 expressing plants, 633 genes showed change in their expression level, of which 231 were upregulated and 402 were downregulated. Out of 633 genes affected in OsSAP11 plants, 143 genes could be assigned functions in different metabolic pathways. In OsSAP11 plants, genes involved in all the steps of GA biosynthesis were upregulated[1].

Subcellular localization

OsSAP11 showed localization in the nucleus in addition to the cytoplasm and plasma membrane. It is worth noting that OsSAP1 and OsSAP11 show differential interactions with OsRLCK253, possibly because of subtle differences in their subcellular localizations[1].

Evolution

It was found that the A20 domain mediates the interaction of OsSAP1 with self, its close homolog OsSAP11 and a rice receptor-like cytoplasmic kinase, OsRLCK253[1].

Knowledge Extension

  • In the recent past, a new family of genes termed as SAP(Stress Associated protein) gene family was studied in rice for its role in abiotic stress conditions by expression profiling under those conditions[2]. SAP gene family members are characterized by the presence of A20/AN1 domain in their putative encoded proteins. The majority was found to have both the A20 zinc-finger domain (present at the N-terminus) and the AN1 zinc-finger domain (present at the C-terminus). This is consistent with the previous finding from animal systems that the A20 and AN1 zinc-finger domains are usually found associated with each other[3].
  • All the members of the rice SAP genenfamily present in the rice genome showed inducibility to one or the other abiotic stresses. SAP gene family members, as in the case of animal systems may be involved in downregulating the pathway associated with abiotic stress injuries such as cell death by ubiquitinylating the key proteins and hence targeting them to degradation[2]. It would be important to define the relative function of the members of this gene family in the life of the rice plant[2][3].
  • Based on the phylogenetic analysis of the AN1 zincfinger domains, Jin et al.[4] recently divided all A20/AN1 zincfinger-containing SAP genes into two groups: Type I and Type II. Type I genes contain the traditional pattern of cysteine- and histidine-rich motifs, whereas Type II SAP genes contain the expanded domain CX4CX2CX9-12CX1-2CX4CX2HX5HXC where X represents any amino acid. Most Type I genes lack introns and contain one intact A20 type domain and/or one AN1 type zincfinger domain; most Type II genes have a single intron but do not contain an A20 domain[4][5].

Labs working on this gene

  • Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110021, India
  • National Institute of Plant Genome Research, Aruna Asaf Ali Road, New Delhi 110067, India

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Giri J, Vij S, Dansana P K, et al. Rice A20/AN1 zinc‐finger containing stress‐associated proteins (SAP1/11) and a receptor‐like cytoplasmic kinase (OsRLCK253) interact via A20 zinc‐finger and confer abiotic stress tolerance in transgenic Arabidopsis plants[J]. New Phytologist, 2011, 191(3): 721-732.
  2. 2.0 2.1 2.2 2.3 2.4 Vij S, Tyagi A K. Genome-wide analysis of the stress associated protein (SAP) gene family containing A20/AN1 zinc-finger (s) in rice and their phylogenetic relationship with Arabidopsis[J]. Molecular Genetics and Genomics, 2006, 276(6): 565-575.
  3. 3.0 3.1 Evans P, Ovaa H, Hamon M, et al. Zinc-finger protein A20, a regulator of inflammation and cell survival, has de-ubiquitinating activity[J]. Biochem. J, 2004, 378: 727-734.
  4. 4.0 4.1 Jin Y, Wang M, Fu J, et al. Phylogenetic and expression analysis of ZnF-AN1 genes in plants[J]. Genomics, 2007, 90(2): 265-275.
  5. Saad R B, Zouari N, Ramdhan W B, et al. Improved drought and salt stress tolerance in transgenic tobacco overexpressing a novel A20/AN1 zinc-finger “AlSAP” gene isolated from the halophyte grass Aeluropus littoralis[J]. Plant molecular biology, 2010, 72(1-2): 171-190.

Structured Information