|
|
| (22 intermediate revisions by 2 users not shown) |
| Line 1: |
Line 1: |
| − | {{JaponicaGene|
| + | Please input one-sentence summary here. |
| − | GeneName = Os09g0244900|
| + | |
| − | Description = Transport protein particle (TRAPP) component, Bet3 family protein|
| + | ==Annotated Information== |
| − | Version = NM_001069192.2 GI:297609099 GeneID:4346489|
| + | ===Function=== |
| − | Length = 6323 bp|
| + | The TRAPP complexes, large multimeric assemblies that function in membrane traffic, are guanine nucleotide exchange factors (GEF) that activate the Rab GTPase Ypt1p.Ypt1p is activated by a large multisubunit complex called TRAPP that also functions in tethering. TRAPP is found in two forms: TRAPPI mediates traffic from the ER to the early Golgi, while TRAPPII plays a role in transport to the late Golgi. The two TRAPP complexes share seven subunits (Bet3p, Bet5p, Trs31p, Trs33p, Trs23p, Trs20p, and Trs85p), of which four (Bet3p, Bet5p, Trs23p, Trs31p) are required for the activation of Ypt1p.TRAPP is thus an unusual GEF in that its activity does not reside in a single subunit but instead requires a minimal five-subunit subcomplex comprising four different proteins<ref name="ref1" />. |
| − | Definition = Oryza sativa Japonica Group Os09g0244900, complete gene.|
| + | |
| − | Source = Oryza sativa Japonica Group
| + | ===Expression=== |
| | + | Ypt/Rabs are activated by guanine-nucleotide exchange factors (GEFs) and the GEF for Ypt1 and Ypt31/32 is the TRAPP complex. TRAPP is a multisubunit modular complex (Sacher et al. 2008), which exists in at least three forms. TRAPP I, which contains five essential subunits, acts as a GEF for Ypt1 (Jones et al. 2000; Wang et al. 2000), and is required for ER-to-Golgi transport (Sacher et al. 1998). Trs85, a TRAPP subunit, nonessential for cell viability, plays a role in autophagy (Meiling-Wesse et al. 2005; Nazarko et al. 2005). A Trs85-containing TRAPP complex, termed TRAPP III, also acts as a Ypt1 GEF (Lynch-Day et al. 2010). TRAPP II, which contains Trs120 and Trs130 in addition to TRAPP I subunits, functions at the trans-Golgi (Sacher et al. 2001). However, currently the Ypt GEF specificity of the TRAPP II complex is under dispute.<ref name="ref2" />. |
| | + | |
| | + | ===Extention=== |
| | + | The interaction of Ypt1p with guanine nucleotides (GDP or GTP) and TRAPP, as with other GTPases and exchange factors,2 is defined by the following closed, cyclic reaction scheme of linked equilibria (Figure 1[[File:Nihms-121360-f0006.jpg|right|thumb|120px|Figure 1(from reference <ref name="ref1" />).]]): where GNP represents either GDP or GTP and Ki represent the overall dissociation equilibrium constants for binding of a given ligand. The results in the following sections are discussed in terms of this Scheme, which has been used in characterizing other exchange factors. |
| | + | |
| | + | ==Labs working on this gene== |
| | + | 1 Yale University, Department of Molecular Biophysics & Biochemistry, 260 Whitney Avenue, New Haven 06520 |
| | + | |
| | + | 2 Department of Cell Biology, Yale University School of Medicine, 333 Cedar Street, New Haven, Connecticut 06520 |
| | + | |
| | + | 3 The Howard Hughes Medical Institute and the Department of Cellular and Molecular Medicine, University of California at San Diego, La Jolla, CA 92093-0668 |
| | + | |
| | + | 4 Department of Biochemistry and Molecular Genetics, University of Illinois, 900 S. Ashland Ave., Chicago, IL 60607. |
| | + | |
| | + | 5 College of Life Sciences, Nanjing Agricultural University, Nanjing 210095, People’s Republic of China. |
| | + | |
| | + | ==References=== |
| | + | <references> |
| | + | <ref name="ref1">Harvey F. Chin, Yiying Cai, [...], and Enrique M. De La Cruz.Kinetic Analysis of the Guanine Nucleotide Exchange Activity of TRAPP, a Multimeric Ypt1p Exchange Factor.J Mol Biol. Jun 5, 2009; 389(2): 275–288.</ref> |
| | + | |
| | + | <ref name="ref2"> Shenshen Zou, Yutao Liu, [...], and Nava Segev.Modular TRAPP Complexes Regulate Intracellular Protein Trafficking Through Multiple Ypt/Rab GTPases in Saccharomyces cerevisiae.Genetics. Jun 2012; 191(2): 451–460.</ref> |
| | + | |
| | + | |
| | + | </references> |
| | + | |
| | + | ==Structured Information== |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
| |
| − | AP = Chromosome 9:3935276..3941598|
| |
| − | CDS = 3935389..3935540,3938899..3939016,3939091..3939345|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008402:3935276..3941598
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008402:3935276..3941598
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggtgcgggaggttgcggagagctgtgtcgacggggtggtgatggagatggtggcggcctactgcggccgcttctacgccgccaagccggagctcgccgcccgccgcatcgaggccatcggcttccaggtcggccaccagctcacggagagatataccatggagcgccctcgatttagtgatcatcttgaagcaatcaaatttatctgcaaagacttttggtcagagctattcaagaagcagattgacaatcttaaaactaatcataggggaacatttgttcttcaagataaccgtttccggtggcttactcgtgtttctatagatccatctgtagagagcatggatgcaactgacaatgactctgcaacactaggggatagcgcagcccaaacaacaagcatgcttctgtactttccatgcgggataataagaggtgccttgaccaatttgggtatttcgtgttctgtcactgcagacatgtccaaccttccagcatgtgagttgcactactccttttcatga</cdnaseq>|
| |
| − | AA = <aaseq>MVREVAESCVDGVVMEMVAAYCGRFYAAKPELAARRIEAIGFQV GHQLTERYTMERPRFSDHLEAIKFICKDFWSELFKKQIDNLKTNHRGTFVLQDNRFRW LTRVSIDPSVESMDATDNDSATLGDSAAQTTSMLLYFPCGIIRGALTNLGISCSVTAD MSNLPACELHYSFS</aaseq>|
| |
| − | DNA = <dnaseqindica>114..265#3624..3741#3816..4070#tgggttcgtgcgacgggacctcgattcgtccatccagcttccactacccctccgcgcgctgcctagatctttcctctctctcgcaccctcttattggcggaggaggaggagggatggtgcgggaggttgcggagagctgtgtcgacggggtggtgatggagatggtggcggcctactgcggccgcttctacgccgccaagccggagctcgccgcccgccgcatcgaggccatcggcttccaggtcggccaccagctcacggagaggtaaacgaatctctctctctctcttgctggatggatctgctgctgcgcccctcccccgatctttccggcgagtccgccgacgagggcctcagatcttctcagtcggcagtcgctatcggttcttgctgactccgataaattttgaaatgttgcttttagtcgccctaaataagggcttattaatcagatttcgcaacaatatcgagccttagacttgatcgcgaagcacttcttgtctttgggagcaggagtgcagggccttgcctacaatcaaaatttgggttaattggatccgctattataaatttcacggtttagaaaaataccattactatttggtaccattgccattgcaatttcataagtattatcactacagaccttttcataacattttttgttttttaagaccaaattaccccctcttcttccttcttccttcccctctctcctctcttccagccgacgaactcgtatgagttcagcagctcatgccgcaggctgcagcgctggaagagccgccgcgcaggacactgctgccgatggagctgaaggagagtggcatagagttgtgagagcttgcttgcactcatttaagctaggattcagtaatgtcgtgcggaaacgtacaacatccgttggcctatgtagtgtgtcattgtgtatatgcagagacgtacgggacatgcatttgctgcaagtattcagtgactgaaccatgccaggtaggagtgtatgtgtatacaggcttgttcctatatgctgtgtcgtatggtagggcacagcacctcaactggatcacgcctccaacaatgtggcaaacgctcttgccgtctacaacagcctttctagcacaccgtcgtcgacgtgaacggaccaactgctgccggcagcctctctgaactctgccgagactgcagtcctcgccgtgcagtccagcgccgtggccggctacacaatttcgtcggagtttgttaagctggaggacaggagattgggggaaaataagtagatgagggtagaagaaagggacaattttgtcctaaaaactcagggttaattggatccatgccattataaattttttagttttgacgtatgcaattactattcaactattcagagtcataccaatacaatttttcaggtgtggaaatatatcactacatacccctttgatgtgtttcacaaaatttttagaccaaaatgccctcatcttcttcctttgtctcatcccatctcctgtagtcctgttaatcttcttcctcctatttttccccttccggatctgaatctggcaacttgtcttcttccttctcatttcctctgtcggccatgatgccagtgttgtgctgcgccatctagttcctcttattcccttcgccggccaaccaaggagcggagctcgtcgtcggcgcatcgttgtggaaggtgctgctggtgttgttcgcctgcggcgacttcaccatggcacgtggtcgtcgatgggcacatgctgtccatgatctgacagagtggcctttttcatgtgtaatctcaaactgaacatccttttttatgtgcctaattgagttggtcaaacatcccaaaatccattccactagcttctgctgagcagcaagcaaccaactaccagactaccagtacgtccttcaacagcaggaaaccaaccatgtgcaagaaatgggaagaagaagaagatgaacagcagacaggtcgggtagctctgaccagctgctgcagtttcgtgtatatggggctggtggccggcgccaccgggaccaacaccatcgagcaatggcggttggctcggactaggtgctgcggcatccagatccgatgagcctgaacccaacgccatctttggcacagccgactcgagccagcctgtcccaatcggcaaccccttgcactgaacttgcagcaagaattgagagaaagaagatgtacaggagagatggaaggacaccaaggaagaagaagagggcattttggtctaagaattttgttaaacacattgaaggggtatgtagtggtatattttcaatacctggaaaattgtaatggcatagctcttaatagttgaatggtaatggcatatgtcagaactgaaaaaatgctgtgaaagggtatatagcggcatatctctaacacttgtaaaattgtaatggcatgatttcaaatagatgaataataatggtatatttccaaactgcgaaatttacagtggcatagatccaattaacccaccatatatattccacaattccaaatgttcattccataagttttaacttcagtacatgtctagtatttcgaacaggtcacttgtttaaccgtttactgatgtgtatacaaatttgtaattctagacagtttatctattctcttgactggtactgttgtatcagcctttattaatagatcgcataactggatgccgccagcaccaatgttctgtcagacagggtaaaaaatatatcacatgattacagccatacggagtatatatttttatttaaacaagtacaactcttttttactgcatacctggctttcagtgtagggatccgaaaatgttatcactttgaactgcagtatatcctcaaatatggtgggtactggataggttcatctcatatagccttggagatctagataacatagatcattctggagttaattactccccggcattcttcttgaaattgatgatatatttcctaaacttttgtgtgtgtgtgtgcgggaacttcaaaggactcaacgagctgaaacagttgattgaagaacctttgtaccgatactttgattcatatgcgacagagtttaataatgcttacattttatcgtatggacattttctcgtgcaatatgtatgctcattattacgaaaatcctatattccttcagtaaccattgacatccttagttaaaaggatagggtatgtttgatcgatgattgggtgcttgtttatgactattttcttgagcaaagaattttgaagctaactataaaaaaggttcaacccgtattaatcatttacaaatgtttatgatgtttgtaattatttacaaaacaaaaatgctacttagcaattttagttatagtttattctctttttattttacttttttcagaaatgtgtttgcaattgtttatataatggaagtttcattttaattgctaattaaattttgtatgtttttattgcccttggtcatttattgattgtttcctgaagtatcatattcttgagcacaaatgtaactgctgtctgaattgcatatgtgtattgggttcttacctccactccttgtagtgctgcgattaaccataatttctgttcaaaatcagatataccatggagcgccctcgatttagtgatcatcttgaagcaatcaaatttatctgcaaagacttttggtcagagctattcaagaagcagattgacaatcttaaaactaatcatagggtaatgaatttaaaattcgtaccttattttgcgcttgtgacagaactgatgttacttgacttccctatatgcagggaacatttgttcttcaagataaccgtttccggtggcttactcgtgtttctatagatccatctgtagagagcatggatgcaactgacaatgactctgcaacactaggggatagcgcagcccaaacaacaagcatgcttctgtactttccatgcgggataataagaggtgccttgaccaatttgggtatttcgtgttctgtcactgcagacatgtccaaccttccagcatgtgagttgcactactccttttcatgacctttactttgcatgcaactccatgaggttgcaaaatgcactggatggtactccttctgttttcatataattattgccattagctttatttttcaaactcattaaacatggaatacctcaagggaaaaatattaaagtattttgaatgataaatgttatagtattattctttcctactaactaaaaaaattaaaatactacttgtcaaatgttgaatagtatagtcatgctcattgctgttaaaaaaggctgggccagtacttgaattaagaaaatcagatcagataatgctcaacatgagtgtctccatatgagaaattatttggtgaaaaatcttttggtgaatatgatggataagattttcattgtggatatttagtatctcagattgaataaccttatcacttgatcacacaagcatattcaaaagcactctcatgtggccatcattgatgccccaatcatcaaaaccaagcagagaattttgagaccacctgatcaggtagcaagttccagcttagctgcttaggatagatatgtcaggaagaagcagccagtatctttctagatgattttgatttcatccagatccagttcacgcagcaaacaaagtcttccatatgcaccgtatgtggcatcgacaaaaaataagtatcccacctgccattcttatggaccactggacatgcctcccttctttagcgttatttggctgcttggagcctgcttacttagtgaactgtttggggagctccttgctaagggtgcaaggggattctcttcctattcctcgactaaatcctttctgctgatctgttaaaaaaaaatagtatctatttccgtttgcctttcctagaaggttgttcaaatgtttgtagagatattcttcttgtcatggtctttttgtttctgtactctttttaatgggattttttttttcagtccacagcttatatgtattgagctgaaagagaaattcattttgttcattgaaatgtggaagtaatattcgtacaatgaatatttgaaatcccctagggggaaagggccgtaataaatataactcctccattccaaatttaaggcattttagttttgtcctaggtgaacatctctaactctgaccaagttatagaaaaatgcactaacatctaaaacatcaatttaatttcattgaaatccaccatgaaatatgtattgatagtgcattaattgggtactccatcccattaaacaaggcgcaactgctttgtacgcaaagaccaaggaagctcatgtaacttgtgagatggatgctgcagaactagaggctttaaacaaccaaaggaaaccaaagaatagctagtgcatgcatgcgcatgaacagaaattacaggagtcaagaaggtgcagctgccgttgctgccctatattctgggacttttgaaaaaagcagttgcgtctggtataatgggatggagagagtagtgtagatgttaatatagggccaatttggattgctacctaccaaaattttggtagggtagcaaaccaaacacctctattaaaacactacctttgtcataaatttggctttgcccatgaacttgtgtcttatgggtatattttagcttcaatcctaatcaacattttcaactctttaccctacaacattttggtagggtattaatacaaacacaggcccatatttttctataaacttggtcaaggtttgagaagtttgacttataacaaaactaaaatgtcttatagtagtatggaatggagggagtacatgactctaggttaaactattcgttgatgattgcagttttgagaattataacacatttctccatttgtagttttgtaccataaattccctctgccttttgcagctatgactattatgtgaaatattgcaggttcttttgttgtgcgcataaaaacatgagctgcagattttatgcctgcttgttcgatcaagcggtttgaacattaaagagtgcaagcacgcaatagcctgggaaatacgccttgtagctgctcctttttctttctctttgttcttagaggcacctctttacttactgacttcatcataccttcctttgtgcacatcttaagattgggtgtaattttgtgattcgtgtgaacaagagaagacaaaatgtaatatttctcctgagatactggctagagccatgtaattttgttgtctagcagtggagaatgttttatcttgtatgtgatgcccgcgcacagtcacgattt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069192.2 RefSeq:Os09g0244900]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
The TRAPP complexes, large multimeric assemblies that function in membrane traffic, are guanine nucleotide exchange factors (GEF) that activate the Rab GTPase Ypt1p.Ypt1p is activated by a large multisubunit complex called TRAPP that also functions in tethering. TRAPP is found in two forms: TRAPPI mediates traffic from the ER to the early Golgi, while TRAPPII plays a role in transport to the late Golgi. The two TRAPP complexes share seven subunits (Bet3p, Bet5p, Trs31p, Trs33p, Trs23p, Trs20p, and Trs85p), of which four (Bet3p, Bet5p, Trs23p, Trs31p) are required for the activation of Ypt1p.TRAPP is thus an unusual GEF in that its activity does not reside in a single subunit but instead requires a minimal five-subunit subcomplex comprising four different proteins[1].
Expression
Ypt/Rabs are activated by guanine-nucleotide exchange factors (GEFs) and the GEF for Ypt1 and Ypt31/32 is the TRAPP complex. TRAPP is a multisubunit modular complex (Sacher et al. 2008), which exists in at least three forms. TRAPP I, which contains five essential subunits, acts as a GEF for Ypt1 (Jones et al. 2000; Wang et al. 2000), and is required for ER-to-Golgi transport (Sacher et al. 1998). Trs85, a TRAPP subunit, nonessential for cell viability, plays a role in autophagy (Meiling-Wesse et al. 2005; Nazarko et al. 2005). A Trs85-containing TRAPP complex, termed TRAPP III, also acts as a Ypt1 GEF (Lynch-Day et al. 2010). TRAPP II, which contains Trs120 and Trs130 in addition to TRAPP I subunits, functions at the trans-Golgi (Sacher et al. 2001). However, currently the Ypt GEF specificity of the TRAPP II complex is under dispute.[2].
Extention
The interaction of Ypt1p with guanine nucleotides (GDP or GTP) and TRAPP, as with other GTPases and exchange factors,2 is defined by the following closed, cyclic reaction scheme of linked equilibria (Figure 1
Figure 1(from reference
[1]).
): where GNP represents either GDP or GTP and Ki represent the overall dissociation equilibrium constants for binding of a given ligand. The results in the following sections are discussed in terms of this Scheme, which has been used in characterizing other exchange factors.
Labs working on this gene
1 Yale University, Department of Molecular Biophysics & Biochemistry, 260 Whitney Avenue, New Haven 06520
2 Department of Cell Biology, Yale University School of Medicine, 333 Cedar Street, New Haven, Connecticut 06520
3 The Howard Hughes Medical Institute and the Department of Cellular and Molecular Medicine, University of California at San Diego, La Jolla, CA 92093-0668
4 Department of Biochemistry and Molecular Genetics, University of Illinois, 900 S. Ashland Ave., Chicago, IL 60607.
5 College of Life Sciences, Nanjing Agricultural University, Nanjing 210095, People’s Republic of China.
References=
- ↑ 1.0 1.1 Harvey F. Chin, Yiying Cai, [...], and Enrique M. De La Cruz.Kinetic Analysis of the Guanine Nucleotide Exchange Activity of TRAPP, a Multimeric Ypt1p Exchange Factor.J Mol Biol. Jun 5, 2009; 389(2): 275–288.
- ↑ Shenshen Zou, Yutao Liu, [...], and Nava Segev.Modular TRAPP Complexes Regulate Intracellular Protein Trafficking Through Multiple Ypt/Rab GTPases in Saccharomyces cerevisiae.Genetics. Jun 2012; 191(2): 451–460.
Structured Information