Difference between revisions of "Os09g0363900"

From RiceWiki
Jump to: navigation, search
(References)
(Structured Information)
 
(27 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
0s09g0363900(see as ONI3) encodes a putative o-alcohol dehydrogenase that is necessary for avoiding organ fusions in rice.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Os09g0363900,also called "ONI3(or ONION3)",which is required for avoiding organ fusions in rice.Loss of function mutations of ONI3 showed abnormal organ fusions in developing shoots. The mutant seedlings showed fusions between neighboring organs and also within an organ; they stopped growing soon after germination and subsequently died. ONI3 encode an enzyme that is most similar to Arabidopsis HOTHEAD.
+
Os09g0363900,also called "ONI3(or ONION3)",which is required for avoiding organ fusions in rice.Loss of function mutations of ONI3 showed abnormal organ fusions in developing shoots. The mutant seedlings showed fusions between neighboring organs and also within an organ; they stopped growing soon after germination and subsequently died. ONI3 encode an enzyme that is most similar to Arabidopsis HOTHEAD.<ref name="ref1" />
 +
[[File:Function.png]]
  
 
===Expression===
 
===Expression===
ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.
+
ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.<ref name="ref1" /><ref name="ref2" />
 +
[[File:Expression1.png||500px|]][[File:Expression2.png||500px|]]
  
 
===Evolution===
 
===Evolution===
 
ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in
 
ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in
their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically.
+
their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically.<ref name="ref1" /><ref name="ref3" />
 +
 
 +
A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.<ref name="ref1" /><ref name="ref4" />
 +
[[File:Evolution.png]]
 +
 
  
A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.
 
  
  
Line 22: Line 27:
  
 
==References==
 
==References==
1,Akiba T, Hibara K, Kimura F, Tsuda K, Shibata K, Ishibashi M, Moriya C, Nakagawa K, Kurata N, Itoh J, Ito Y. (2014)  Organ fusion and defective shoot development in oni3 mutants of rice.Plant Cell Physiol. 55(1): 42–51
+
<references>
 
+
<ref name="ref1">Akiba T, Hibara K, Kimura F, Tsuda K, Shibata K, Ishibashi M, Moriya C, Nakagawa K, Kurata N, Itoh J, Ito Y. (2014)  Organ fusion and defective shoot development in oni3 mutants of rice.Plant Cell Physiol. 55(1): 42–51</ref>
2,Kurdyukov, S., Faust, A., Trenkamp, S., Bar, S., Franke, R., Efremova, N. et al. (2006) Genetic and biochemical evidence for involvement of HOTHEAD in the biosynthesis of long-chain a-, o-dicarboxylic fatty acids and formation of extracellular matrix. Planta 224: 315–329.
+
<ref name="ref2">Fujita, M., Horiuchi, Y., Ueda, Y., Mizuta, Y., Kubo, T., Yano, K. et al.(2010) Rice expression atlas in reproductive development. Plant Cell Physiol. 51: 2060–2081</ref>
 
+
<ref name="ref3">Kurdyukov, S., Faust, A., Trenkamp, S., Bar, S., Franke, R., Efremova, N. et al. (2006) Genetic and biochemical evidence for involvement of HOTHEAD in the biosynthesis of long-chain a-, o-dicarboxylic fatty acids and formation of extracellular matrix. Planta 224: 315–329</ref>
3,Fujita, M., Horiuchi, Y., Ueda, Y., Mizuta, Y., Kubo, T., Yano, K. et al.(2010) Rice expression atlas in reproductive development. Plant Cell Physiol. 51: 2060–2081.
+
<ref name="ref4">Kouchi, H. and Hata, S. (1993) Isolation and characterization of novel nodulin cDNAs representing genes expressed at early stages of soybean nodule development. Mol. Gen. Genet. 238: 106–119.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0363900|
 
Description = Similar to HOTHEAD protein precursor (ADHESION OF CALYX EDGES protein)|
 
Version = NM_001069531.1 GI:115478804 GeneID:4346864|
 
Length = 5043 bp|
 
Definition = Oryza sativa Japonica Group Os09g0363900, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:12525599..12530641|
 
CDS = 12525764..12525818,12525923..12526494,12526947..12527335,12527480..12527793,12529490..12529844<br>,12530466..12530538|
 
GCID = <gbrowseImage1>
 
name=NC_008402:12525599..12530641
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:12525599..12530641
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctttgagcaagagaatgctattcatcttccaggccatggtttgcctctgctccttcagtttatcccaaggcaaccagcaattcagcttaaggaatctccctaccctccagaaggcgagcagcttcccagcgatgcgccacgagacatacgactacattgtcgtcggcgggggcaccgccggttgccccctggcggcgacattgtcgctcaagtacaaggtgctcctgctggagaggggagggtctccgtatggcaaccgcaacgtctcctacatggagaacttccacattggcctgagcaatatggcgccggactcggcgtctcaggccttcatctccactgacggcgtcatcaatgcccgagcgagggtgttgggaggtggcacctgcatcaatgccggcttctacagccgggccagctcaaacttcatccaggaggtaggctgggatgaagacctggtgaatgagtccttcccttgggtggaggacaagatcgtccagtggcctaagatcgcaccttggcaggctgcactaagggatgggctactccaagcaggtgtatctcctttcaatggctacacatatgaccatgtttctgggaccaaagttggtggcaccatctttgatgagactggctaccgccacacagcagccgacttacttgcagctggagaccctaacaacctaagggtgctgcttcatgctagtgtgaacaggatagtctttaactcgcagagagggcaactgaagccaagagcaaccggagttcagttcaccgatgagaatggaggactccaccaggcattcctcaacagcaactgtgatagtgaaatcattgtctctgctggcgcaattggcagcccccagctgctattgctcagtgggattggacccaagaatgaccttaggagccataaaattcctgtagttctccataacaagtatgtgggtaaagggatggctgataaccccatgaactccatattcataccgacgaaaagcccccctcgccagtccctgattgagactgttggaataactgaagctggtgtgttcattgaggccagtagtggttttggccagtcaccagaaagcatccattgccaccatggaatcatgtccgctgagattggacagctgtccacaattcctccgaaggaaagaagcctggaaaaagcacagaagtatgcaaataccaaacttaatctacccaaagagatattccatggtggttttatcctcgagaagattgatggtccactgtctacgggacatcttgccctgatagacactgatgtcaagaagaaccctgcggttaccttcaactacttcagtcatccacaggatctcactcgttgcgtctatggtatcaagaccattgaacgaatactgaagacaaaccgtttctctgaactgtctgccaacactgatggacattcaatggaaagagtgctcaatatgagtgtgcaggctaatgtgaacttgatacccaagcatacaaatgacacagaatccctagagcaattttgcagggatacagtaataaccatctggcactaccatggtggatgccatgtagggaaggtggttgatcagcaacaccgtgtgcttggagtttcaggcgtccgtgtagtcgatggctcaacattttctagatcaccagggacgaaccctcaagccacggtcatgatgatgggcagatattttggagtgatgatcctaaggggaagactaggtcgagcagctggagtgtaa</cdnaseq>|
 
AA = <aaseq>MALSKRMLFIFQAMVCLCSFSLSQGNQQFSLRNLPTLQKASSFP                    AMRHETYDYIVVGGGTAGCPLAATLSLKYKVLLLERGGSPYGNRNVSYMENFHIGLSN                    MAPDSASQAFISTDGVINARARVLGGGTCINAGFYSRASSNFIQEVGWDEDLVNESFP                    WVEDKIVQWPKIAPWQAALRDGLLQAGVSPFNGYTYDHVSGTKVGGTIFDETGYRHTA                    ADLLAAGDPNNLRVLLHASVNRIVFNSQRGQLKPRATGVQFTDENGGLHQAFLNSNCD                    SEIIVSAGAIGSPQLLLLSGIGPKNDLRSHKIPVVLHNKYVGKGMADNPMNSIFIPTK                    SPPRQSLIETVGITEAGVFIEASSGFGQSPESIHCHHGIMSAEIGQLSTIPPKERSLE                    KAQKYANTKLNLPKEIFHGGFILEKIDGPLSTGHLALIDTDVKKNPAVTFNYFSHPQD                    LTRCVYGIKTIERILKTNRFSELSANTDGHSMERVLNMSVQANVNLIPKHTNDTESLE                    QFCRDTVITIWHYHGGCHVGKVVDQQHRVLGVSGVRVVDGSTFSRSPGTNPQATVMMM                    GRYFGVMILRGRLGRAAGV</aaseq>|
 
DNA = <dnaseqindica>4824..4878#4148..4719#3307..3695#2849..3162#798..1152#104..176#aggaaacaggggagggagagaggttttgccaccgttgttttggagggaaggaaaatcctaagaaggggaaagagtttagcttggcaggtggttctcaggctcaatggctttgagcaagagaatgctattcatcttccaggccatggtttgcctctgctccttcagtttatcccaaggtgcgcatctcttgtggttctgtctcatctcatgtttctcaggcattcctcctctattctgtattctgtctcatctcatgtttctcaggcattcctcctttattctgtacatttctgttccaccttcccattgaagaacttgcaatggtgaaatgcagttatatatgctagtttttgcttagcttctttctcgcaagaatatcattatcacgtgcacttccattatctgacactttggttcctatcattgtttatcgccacattggcctcaccactagtatttgagagtagcagaacatctaatcattcagagttcaatatttagagattgaaggataggaaataaatagtcaacacaatgccacaagacgtacctctcatccagtcctaggaggtacaatgccaactgccaagaggtccagaccctagtaatcatagcatcaattagattgatacactcatttatcaacatgcaaaaacaggttatgtttttagataatgaaagcttttattgaagtcatgcaaaaaaaaaaagggggttatagcatgagaaacttacagcagaacaaagcaaaactttttcaggcaatgacaacattatggaacactttgttttctcaggcaaccagcaattcagcttaaggaatctccctaccctccagaaggcgagcagcttcccagcgatgcgccacgagacatacgactacattgtcgtcggcgggggcaccgccggttgccccctggcggcgacattgtcgctcaagtacaaggtgctcctgctggagaggggagggtctccgtatggcaaccgcaacgtctcctacatggagaacttccacattggcctgagcaatatggcgccggactcggcgtctcaggccttcatctccactgacggcgtcatcaatgcccgagcgagggtgttgggaggtggcacctgcatcaatgccggcttctacagccgggccagctcaaagtaagcaattgcattgcacagatatggatgctatcttgtgtatcagtattcttacctgattatgattgttctcttccgtctacgagtgaccagccaagagagttcacagttcacacatgcaaatttaaccttttttttactgccgaagtgcagaatggtcagcattaatatatacacacaaacatatgcaagagaattcacagttcacacatgcaaatttaacctttttttttactgccgaagtgcagaatggtctcaatcatgatcaagacttcagatataatttactattatattctttaccataagagggcaagcacaaatagcagagcctaaaatgaagttagcataagtagattaaatataccaagtagtctctcagtatatgcaacacatggcctatcactttcacatgaacaaacatcagctctagggtaaatgcagagcagtgatagtgccagtagaaattactaatggtaactggtaagatctgcttgactgctgccaccctagcatactgcagccacctttgttcacccttcaagtggagtaatagctgtctgctgaaacgtgcagcagaacactaaatattattcactgttctcaatagtagcattcaattaccatgaaaccaaagtttctgccaattaggattctctggctacaacctcttgtttcttttctccagcgtccaaatggaaaagggaaaacggggaaacaaacaaacactaattagtgtagctcaaataggttctaatcgactaaaatgagccagccaaaagacacaaatgcataaaaccaccacctgcattactagcactcactctagaacgtacccagcactgcatttggacatgattatcggttcactaggactacatattttggttggtatgattctagacttctagtttatggttatcaaaatgcaggctttctttgagatttatcacaatgcagctctgcaatatataacgaaataaaatccagctgtaaaattagcaaaggttgtactttgagtgcttgcatacaaatgagcactagtgagaaagttgataacataaagaaaataagcagattgcaaaagtggtttgcattaaagtgcttcagtctggtattgcaaataattaactacgctggcagcagcacatgctgtggttttctcagtgaataaaaagacttccttgctcttcttgcagtcatgaactacatgttactgaaacagactagattgaaaagagacattgatgaaaaaaaaaaagagagagacaacaaaacaaaatcacatggggctataattgtttctttgcagtcatggtaactaagttgtctaggcaaaggacactaaataactaaaaccctagtagactcgaggctacttcaagtttgggccaattagtacatatgcattcgaattatttgtacagaatcgaattacaataggtcaatgggtgggccccacacacccgtgctcatcagtcatccctagtgatatacctgctcattaccagaaacgccaatgtgacttaaaaggtatcaataattgataagcttaatcccgtagtcttcaagaaggaattttacttctatattgatattcatattggtgaactacatgttaaattgttattggtgaactacatgttaaattgctaataacttgtataccatgtgtttttgttcttgaaacaaacagcttcatccaggaggtaggctgggatgaagacctggtgaatgagtccttcccttgggtggaggacaagatcgtccagtggcctaagatcgcaccttggcaggctgcactaagggatgggctactccaagcaggtgtatctcctttcaatggctacacatatgaccatgtttctgggaccaaagttggtggcaccatctttgatgagactggctaccgccacacagcagccgacttacttgcagctggagaccctaacaacctaagggtgctgcttcatgctagtgtgaacaggatagtctttaactcgcagagaggtaaataattacacatgtgtggccaaagctcctacaagttgtattatcttctaaaatagagttatatagaattatatgccatgaatagaaagagtaagttcagtaatcacgtaccatatttcagatacaccatttctgatgcagggcaactgaagccaagagcaaccggagttcagttcaccgatgagaatggaggactccaccaggcattcctcaacagcaactgtgatagtgaaatcattgtctctgctggcgcaattggcagcccccagctgctattgctcagtgggattggacccaagaatgaccttaggagccataaaattcctgtagttctccataacaagtatgtgggtaaagggatggctgataaccccatgaactccatattcataccgacgaaaagcccccctcgccagtccctgattgagactgttggaataactgaagctggtgtgttcattgaggccagtagtggttttggccagtcaccagaaagcatccattgccaccatggaatcatgtccgctgaggtatgtcatcaatcttacttgcatcatgagaagctttttgtgcataaaataggtctaaagcagtatcacaaacatcaggaaaaagctgctgcttagatctgcagacttcaaaaaggaaaacagattctaaagtctaaactatcaaaactcacattttgcaacattgcaaacacaacttagaccaattcattaattacaggtgaatatgcatatgcatataatagtatattctaagaaataatacttatctgatttataagtcattgttttatgcttagattttctaggaatcagatctcagaattgaacttcttgtcttggagattaaaaaaaataagtgttgtctacattgcaacaactccaataactgccatcatagtttccattgttgtctcaatttgttccctacttggccttgttggtctaatacatattatattcctatggtacagattggacagctgtccacaattcctccgaaggaaagaagcctggaaaaagcacagaagtatgcaaataccaaacttaatctacccaaagagatattccatggtggttttatcctcgagaagattgatggtccactgtctacgggacatcttgccctgatagacactgatgtcaagaagaaccctgcggttaccttcaactacttcagtcatccacaggatctcactcgttgcgtctatggtatcaagaccattgaacgaatactgaagacaaaccgtttctctgaactgtctgccaacactgatggacattcaatggaaagagtgctcaatatgagtgtgcaggctaatgtgaacttgatacccaagcatacaaatgacacagaatccctagagcaattttgcagggatacagtaataaccatctggcactaccatggtggatgccatgtagggaaggtggttgatcagcaacaccgtgtgcttggagtttcaggcgtccgtgtagtcgatggctcaacattttctagatcaccagggacgaaccctcaagccacggtcatgatgatgggcaggtacataaacacagtaaaaaattaacttctttagtctttacctaatgatattctaactttaaactcttaaagactaaattgcttccctcatatttcatactcagatattttggagtgatgatcctaaggggaagactaggtcgagcagctggagtgtaatcgattcctggacaccagccttttgttatgtgtgacctagagaagaaaaattactaattattgctgggatctagtgtgattcaccgaagaaagacaagctaggagtttcatctgtacccagtaatcatttgtgtcatgtgatattgcagatcaaatggtttattg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069531.1 RefSeq:Os09g0363900]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:40, 12 June 2015

0s09g0363900(see as ONI3) encodes a putative o-alcohol dehydrogenase that is necessary for avoiding organ fusions in rice.

Annotated Information

Function

Os09g0363900,also called "ONI3(or ONION3)",which is required for avoiding organ fusions in rice.Loss of function mutations of ONI3 showed abnormal organ fusions in developing shoots. The mutant seedlings showed fusions between neighboring organs and also within an organ; they stopped growing soon after germination and subsequently died. ONI3 encode an enzyme that is most similar to Arabidopsis HOTHEAD.[1] Function.png

Expression

ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.[1][2] Expression1.pngExpression2.png

Evolution

ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically.[1][3]

A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.[1][4] Evolution.png



You can also add sub-section(s) at will.

Labs working on this gene

Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan

References

  1. 1.0 1.1 1.2 1.3 Akiba T, Hibara K, Kimura F, Tsuda K, Shibata K, Ishibashi M, Moriya C, Nakagawa K, Kurata N, Itoh J, Ito Y. (2014) Organ fusion and defective shoot development in oni3 mutants of rice.Plant Cell Physiol. 55(1): 42–51
  2. Fujita, M., Horiuchi, Y., Ueda, Y., Mizuta, Y., Kubo, T., Yano, K. et al.(2010) Rice expression atlas in reproductive development. Plant Cell Physiol. 51: 2060–2081
  3. Kurdyukov, S., Faust, A., Trenkamp, S., Bar, S., Franke, R., Efremova, N. et al. (2006) Genetic and biochemical evidence for involvement of HOTHEAD in the biosynthesis of long-chain a-, o-dicarboxylic fatty acids and formation of extracellular matrix. Planta 224: 315–329
  4. Kouchi, H. and Hata, S. (1993) Isolation and characterization of novel nodulin cDNAs representing genes expressed at early stages of soybean nodule development. Mol. Gen. Genet. 238: 106–119.

Structured Information