Difference between revisions of "Os09g0439200"

From RiceWiki
Jump to: navigation, search
(Structured Information)
 
(23 intermediate revisions by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
OsJAZ8, a rice jasmonate ZIM-domain protein, acts as a repressor of JA signaling and negatively regulates the JA-induced resistance to Xoo in rice.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
OsJAZ8 is a rice jasmonate ZIM-domain protein and acts as a repressor of JA signaling in rice.OsJAZ8 negatively regulates the JA-induced resistance toXooin rice. OsJAZ8exhibited the highest up-regulation among the JA-responsiveJAZ genes in rice. OsJAZ8 interacted with OsCOI1H, which is a component of the SCF complex,in a coronatine-dependent manner and was degraded via the 26S proteasome pathway in a COR-dependent manner. Furthermore, the JA-dependent OsJAZ8 degradation was mediated by the Jas domain. OsJAZ8 may function as a heterodimer with other JAZ proteins to repress JA signaling in rice, but did not form homodimer<ref name="ref1" />.
+
OsJAZ8 is a rice jasmonate ZIM-domain protein and acts as a repressor of JA signaling in rice.OsJAZ8 negatively regulates the JA-induced resistance toXooin rice. OsJAZ8 exhibited the highest up-regulation among the JA-responsive JAZ genes in rice. OsJAZ8 interacted with OsCOI1H, which is a component of the SCF complex,in a coronatine-dependent manner and was degraded via the 26S proteasome pathway in a COR-dependent manner. Furthermore, the JA-dependent OsJAZ8 degradation was mediated by the Jas domain. OsJAZ8 may function as a heterodimer with other JAZ proteins to repress JA signaling in rice, but did not form homodimer<ref name="ref1" />.
 +
 
 +
===Mutation===
 +
Transgenic rice plants overexpressing OsJAZ8ΔC, which lacks the Jas domain, exhibited a JA-insensitive phenotype. The qRT–PCR experiment and a large-scale analysis using a rice DNA microarray both revealed that overexpression of OsJAZ8ΔC altered the expression of JA-responsive genes, including defense-related genes, in rice. Furthermore, OsJAZ8ΔC negatively regulated the JA-induced resistance to Xoo in rice<ref name="ref1" />.
  
 
===Expression===
 
===Expression===
OsTIFY family genes had distinct expression patterns.OsTIFY10c showed high expression in the callus and leaves.
+
[[File:Exa.jpg|right|thumb|150px|''OsJAZ8 gene response to JA and pathogen attack (from reference <ref name="ref1" />).'']]
qRT–PCR analysis of JAZ genes in rice after treatment with 100mM JA for 24 h, EightJAZ genes (OsJAZ 1, 3, 4, 7, 8, 9, 10and 12) were significantly up-regulated by JA, with OsJAZ8 exhibiting the highest up-regulation among the JA-responsive JAZ genes in rice (Fig. 2A). After JA treatment, OsJAZ8 expression reached a maximum level at 24 h in the tested period (Fig. 2B). However, after inoculation with virulent Xoo, OsJAZ8 expression was not up-regulated in the tested period (Fig. 2C).When the Jas domain-truncated OsJAZ8 (OsJAZ8�C) was
+
 
overexpressed in rice, the transgenic rice plants exhibited
+
OsTIFY family genes had distinct expression patterns. OsTIFY10c showed high expression in the callus and leaves<ref name="ref2" />. The expression of OsTIFY10c could be induced by JA and wounding treatments<ref name="ref2" />. QRT–PCR analysis of JAZ genes in rice after treatment with 100mM JA for 24 h, EightJAZ genes (OsJAZ 1, 3, 4, 7, 8, 9, 10and 12) were significantly up-regulated by JA, with OsJAZ8 exhibiting the highest up-regulation among the JA-responsive JAZ genes in rice (Fig. 2A). After JA treatment, OsJAZ8 expression reached a maximum level at 24 h in the tested period (Fig. 2B). However, after inoculation with virulent Xoo, OsJAZ8 expression was not up-regulated in the tested period (Fig. 2C).When the Jas domain-truncated OsJAZ8 (OsJAZ8ΔC) was overexpressed in rice, the transgenic rice plants exhibited JA-insensitive phenotypes, such as resistance to JA-induced inhibition of root growth and inhibition of JA-induced Chl reduction. These results indicate that expression of OsJAZ8ΔC inhibits JA responsiveness via the dominant-negative activity of the altered OsJAZ8 protein<ref name="ref1" />.
JA-insensitive phenotypes, such as resistance to JA-induced inhibition of root growth and inhibition of JA-induced Chl reduction. These results indicate that expression of OsJAZ8�C
 
inhibits JA responsiveness via the dominant-negative activity
 
of the altered OsJAZ8 protein.
 
  
 
===Evolution===
 
===Evolution===
JAZ (JASMONATE ZIM-DOMAIN) is a subfamily of TIFY. The 12 members of this subfamily contain the TIFY domain and a C-terminal conserved domain designated as Jas which has a characteristic motif of SLX2FX2KRX2RX5PY (reviewed by Staswick2008).  
+
[[File:Exam.jpg|right|thumb|150px|''Phylogenetic tree of the OsTIFY proteins and TIFY proteins of ''Arabidopsis'' (from reference <ref name="ref2" />).'']]
  
The TIFY family owes its name to a conserved TIFY domain with a highly conserved amino acid pattern of TIF [F/Y]XG in the protein sequences.  
+
JAZ (JASMONATE ZIM-DOMAIN) is a subfamily of TIFY. The 12 members of this subfamily contain the TIFY domain and a C-terminal conserved domain designated as Jas which has a characteristic motif of SLX2FX2KRX2RX5PY<ref name="ref3" />. The TIFY family owes its name to a conserved TIFY domain with a highly conserved amino acid pattern of TIF [F/Y]XG in the protein sequences. To analyze the evolutionary relationships of the OsTIFY genes, a phylogenetic tree was generated using the sequence alignments of 38 full-length TIFY proteins, including 20 from rice and 18 from ''Arabidopsis thaliana''. The 38 TIFY proteins were also classified into two major groups (I and II) according to the unrooted phylogenetic tree (Fig.1). Four proteins with the GATA zincfinger and CCT domains (OsTIFY1a, 1b, 2a, and 2b) were clustered together in group I. The proteins without the GATA zinc-finger and CCT domains consist of the second major group (group II), and this group contains all the JAZ gene cluster (OsTIFY11e, OsTIFY11f, and OsTIFY11d)on chromosome 10. Among the 20 OsTIFY genes, 16 members are located either in tandem duplication (11a, 11b, and 11c; 1aand1b, and 11e, 11f, and 11d) or in the duplicated segmental regions of rice chromosomes (2a, 2b, 6a, 6b, 10a, 10b, 11a, 11b, 11c, 11d, 11e, 11f, 11g, and 5; Fig. 1). Only four OsTIFY members (OsTIFY3, 8, 9,and10c) are located in nonduplication regions<ref name="ref2" />.
To analyze the evolutionary relationships of theOsTIFY
 
genes, a phylogenetic tree was generated using the
 
sequence alignments of 38 full-length TIFY proteins,
 
including 20 from rice and 18 from ''Arabidopsis thaliana''. The 38 TIFY proteins were also classified into two
 
major groups (I and II) according to the unrooted phylogenetic tree (Fig.1). Four proteins with the GATA zincfinger and CCT domains (OsTIFY1a, 1b, 2a, and 2b) were
 
clustered together in group I. The proteins without the
 
GATA zinc-finger and CCT domains consist of the second
 
major group (group II), and this group contains all the JAZ gene cluster (OsTIFY11e, OsTIFY11f, and OsTIFY11d)on
 
chromosome 10. Among the 20OsTIFYgenes, 16 members are located either in tandem duplication (11a, 11b, and
 
11c; 1aand1b, and 11e, 11f, and 11d) or in the duplicated
 
segmental regions of rice chromosomes (2a, 2b, 6a, 6b,
 
10a, 10b, 11a, 11b, 11c, 11d, 11e, 11f, 11g, and 5; Fig. 1).
 
Only fourOsTIFYmembers (OsTIFY3, 8, 9,and10c) are
 
located in nonduplication regions.
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Faculty of Agriculture and Gene Research Center, Kagawa University, Miki, Kagawa, 761-0795 Japan
 +
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan)
 +
*College of Life Sciences and Technology, Huazhong Agricultural University, 430070 Wuhan, China
  
 
==References==
 
==References==
Line 39: Line 27:
 
* <ref name="ref1">Shoko Yamada;Akihito Kano;Daisuke Tamaoki;Ayumi Miyamoto;Hodaka Shishido;Seika Miyoshi;Shiduku Taniguchi;Kazuya Akimitsu;Kenji Gomi
 
* <ref name="ref1">Shoko Yamada;Akihito Kano;Daisuke Tamaoki;Ayumi Miyamoto;Hodaka Shishido;Seika Miyoshi;Shiduku Taniguchi;Kazuya Akimitsu;Kenji Gomi
 
   Involvement of OsJAZ8 in Jasmonate-Induced Resistance to Bacterial Blight in Rice
 
   Involvement of OsJAZ8 in Jasmonate-Induced Resistance to Bacterial Blight in Rice
   Plant and Cell Physiology, 2012, 53(12): 2060-2072
+
   Plant and Cell Physiology, 2012, 53(12): 2060-2072</ref>
 +
* <ref name="ref2">Haiyan Ye;Hao Du;Ning Tang;Xianghua Li;Lizhong Xiong
 +
  Identification and expression profiling analysis of TIFY family genes involved in stress and phytohormone responses in rice
 +
  Plant Molecular Biology, 2009, 71(3): 291-305</ref>
 +
* <ref name="ref3">
 +
Staswick PE (2008) JAZing up jasmonate signaling. Trends Plant Sci
 +
13:66–71</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os09g0439200|
 
Description = ZIM domain containing protein|
 
Version = NM_001069808.1 GI:115479358 GeneID:4347164|
 
Length = 1747 bp|
 
Definition = Oryza sativa Japonica Group Os09g0439200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
 
AP = Chromosome 9:16927233..16928979|
 
CDS = 16927643..16927760,16927878..16927935,16928082..16928272,16928493..16928643,16928730..16928910<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008402:16927233..16928979
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008402:16927233..16928979
 
source=RiceChromosome09
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggccggccgtgcgacggcgacggcgacggcggcggggaaggacaggtccagcttcgccgtcacctgtagcctcctcagccagtttctcaaggagaagaagggcggcggcggcgggctgcaggggctcggcctcggcttgcggccggcgccggcggcgccgcccgccgcgggagctggaggtgctttccggccgccgccgaccaccatgaacttgctgtcggggctcgacgcgccggcggtggaggtggagccaaacacggcggaaacagcggccgacgagctgcctctcatcaaggccccggccgatcagcaaagcgacgaaagtgcaagtgaggcagctggagagaaggctcaacagctgaccatcttctacggtggaaaagtagtcgtctttgagaacttcccgtccaccaaggtcaaggatctcttacaaatcgtaagcacaggcgatggcgtcgacaagaacaccggcaccgcggcaacgcagagcctgccccgacccgcacacaacagtcttcccgatctgccgattgcaaggaggaactcgctccataggtttctcgagaagagaaagggcaggatgaatgcaaatgctccataccaagctaactgcaccgctgcaccgtccaagcaagctaacggtgacaaatcttggcttgggtttggccaagagatgacaataaagcaggagatatga</cdnaseq>|
 
AA = <aaseq>MAGRATATATAAGKDRSSFAVTCSLLSQFLKEKKGGGGGLQGLG                    LGLRPAPAAPPAAGAGGAFRPPPTTMNLLSGLDAPAVEVEPNTAETAADELPLIKAPA                    DQQSDESASEAAGEKAQQLTIFYGGKVVVFENFPSTKVKDLLQIVSTGDGVDKNTGTA                    ATQSLPRPAHNSLPDLPIARRNSLHRFLEKRKGRMNANAPYQANCTAAPSKQANGDKS                    WLGFGQEMTIKQEI</aaseq>|
 
DNA = <dnaseqindica>1220..1337#1045..1102#708..898#337..487#70..250#agagagagacaaccagacgggagcttgtcggggaggagagagagagagagtggtggtggtggtggtgagatggccggccgtgcgacggcgacggcgacggcggcggggaaggacaggtccagcttcgccgtcacctgtagcctcctcagccagtttctcaaggagaagaagggcggcggcggcgggctgcaggggctcggcctcggcttgcggccggcgccggcggcgccgcccgccgcgggagctggaggtaataagcgattgtgttcgtcatgcgattaaattagcagcgacttgttttgtttcttaccacgtatggggtgttggtctttgcaggtgctttccggccgccgccgaccaccatgaacttgctgtcggggctcgacgcgccggcggtggaggtggagccaaacacggcggaaacagcggccgacgagctgcctctcatcaaggccccggccgatcagcaaagcgacgaaagtgcaaggtacaaacaatctctagtacactctgcatcctgacatctcacgatctcaaacaaactctctcctgttcattaaaaaagagtagtaaaatgaacataaaacatgttatcctgacttgcaacttgcatccttatacaatgtctagaagaagaagaaaacacacttaattttttggagtagagataatttggttgcaactgtctctttggttctttcttccagtgaggcagctggagagaaggctcaacagctgaccatcttctacggtggaaaagtagtcgtctttgagaacttcccgtccaccaaggtcaaggatctcttacaaatcgtaagcacaggcgatggcgtcgacaagaacaccggcaccgcggcaacgcagagcctgccccgacccgcacacaacagtcttcccggtaataacaactgttcattcttttgcagttttacattttaccatcacagtgctaattaatttccatctactatgcttaaatttatctactacatgtgaaacaatgtaggaatccttaacgaatgactgatttttgatttgttacagatctgccgattgcaaggaggaactcgctccataggtttctcgagaagagaaagggcaggtaggtaactgagtggctttcaacttctatctgaaatacttgcctttcgctgtcaaaaactggctgtcagaccaagtttatggccctaaaattctccatgctcttcaaccactccaggatgaatgcaaatgctccataccaagctaactgcaccgctgcaccgtccaagcaagctaacggtgacaaatcttggcttgggtttggccaagagatgacaataaagcaggagatatgatatgacctcttagcttacagttcactgtcaagtgtcaagtgatctgtggggaagagatgcgtggttggctggttgctagtgctagtgtattcccccgtagcttcaaagcatgaataattactcaatactactacattactactagtaagaacttaatcaatactaggaatcaagctggtggttaattctgcctgaccattggcatcctggaatatatataagcacacacacgggttgtttgttctccacattgtttgctgctggagccgtatgctcactgcagtttatatctgtctagctggttacccacctcagcctcaccatgtttcgggaataaacactgtgtatgtgcaaattcttcatttctcgttcggtttcgccgtataaattacattgttactattttggct</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069808.1 RefSeq:Os09g0439200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 09:42, 12 June 2015

OsJAZ8, a rice jasmonate ZIM-domain protein, acts as a repressor of JA signaling and negatively regulates the JA-induced resistance to Xoo in rice.

Annotated Information

Function

OsJAZ8 is a rice jasmonate ZIM-domain protein and acts as a repressor of JA signaling in rice.OsJAZ8 negatively regulates the JA-induced resistance toXooin rice. OsJAZ8 exhibited the highest up-regulation among the JA-responsive JAZ genes in rice. OsJAZ8 interacted with OsCOI1H, which is a component of the SCF complex,in a coronatine-dependent manner and was degraded via the 26S proteasome pathway in a COR-dependent manner. Furthermore, the JA-dependent OsJAZ8 degradation was mediated by the Jas domain. OsJAZ8 may function as a heterodimer with other JAZ proteins to repress JA signaling in rice, but did not form homodimer[1].

Mutation

Transgenic rice plants overexpressing OsJAZ8ΔC, which lacks the Jas domain, exhibited a JA-insensitive phenotype. The qRT–PCR experiment and a large-scale analysis using a rice DNA microarray both revealed that overexpression of OsJAZ8ΔC altered the expression of JA-responsive genes, including defense-related genes, in rice. Furthermore, OsJAZ8ΔC negatively regulated the JA-induced resistance to Xoo in rice[1].

Expression

OsJAZ8 gene response to JA and pathogen attack (from reference [1]).

OsTIFY family genes had distinct expression patterns. OsTIFY10c showed high expression in the callus and leaves[2]. The expression of OsTIFY10c could be induced by JA and wounding treatments[2]. QRT–PCR analysis of JAZ genes in rice after treatment with 100mM JA for 24 h, EightJAZ genes (OsJAZ 1, 3, 4, 7, 8, 9, 10and 12) were significantly up-regulated by JA, with OsJAZ8 exhibiting the highest up-regulation among the JA-responsive JAZ genes in rice (Fig. 2A). After JA treatment, OsJAZ8 expression reached a maximum level at 24 h in the tested period (Fig. 2B). However, after inoculation with virulent Xoo, OsJAZ8 expression was not up-regulated in the tested period (Fig. 2C).When the Jas domain-truncated OsJAZ8 (OsJAZ8ΔC) was overexpressed in rice, the transgenic rice plants exhibited JA-insensitive phenotypes, such as resistance to JA-induced inhibition of root growth and inhibition of JA-induced Chl reduction. These results indicate that expression of OsJAZ8ΔC inhibits JA responsiveness via the dominant-negative activity of the altered OsJAZ8 protein[1].

Evolution

Phylogenetic tree of the OsTIFY proteins and TIFY proteins of Arabidopsis (from reference [2]).

JAZ (JASMONATE ZIM-DOMAIN) is a subfamily of TIFY. The 12 members of this subfamily contain the TIFY domain and a C-terminal conserved domain designated as Jas which has a characteristic motif of SLX2FX2KRX2RX5PY[3]. The TIFY family owes its name to a conserved TIFY domain with a highly conserved amino acid pattern of TIF [F/Y]XG in the protein sequences. To analyze the evolutionary relationships of the OsTIFY genes, a phylogenetic tree was generated using the sequence alignments of 38 full-length TIFY proteins, including 20 from rice and 18 from Arabidopsis thaliana. The 38 TIFY proteins were also classified into two major groups (I and II) according to the unrooted phylogenetic tree (Fig.1). Four proteins with the GATA zincfinger and CCT domains (OsTIFY1a, 1b, 2a, and 2b) were clustered together in group I. The proteins without the GATA zinc-finger and CCT domains consist of the second major group (group II), and this group contains all the JAZ gene cluster (OsTIFY11e, OsTIFY11f, and OsTIFY11d)on chromosome 10. Among the 20 OsTIFY genes, 16 members are located either in tandem duplication (11a, 11b, and 11c; 1aand1b, and 11e, 11f, and 11d) or in the duplicated segmental regions of rice chromosomes (2a, 2b, 6a, 6b, 10a, 10b, 11a, 11b, 11c, 11d, 11e, 11f, 11g, and 5; Fig. 1). Only four OsTIFY members (OsTIFY3, 8, 9,and10c) are located in nonduplication regions[2].

Labs working on this gene

  • Faculty of Agriculture and Gene Research Center, Kagawa University, Miki, Kagawa, 761-0795 Japan
  • National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan)
  • College of Life Sciences and Technology, Huazhong Agricultural University, 430070 Wuhan, China

References

  1. 1.0 1.1 1.2 1.3 Shoko Yamada;Akihito Kano;Daisuke Tamaoki;Ayumi Miyamoto;Hodaka Shishido;Seika Miyoshi;Shiduku Taniguchi;Kazuya Akimitsu;Kenji Gomi Involvement of OsJAZ8 in Jasmonate-Induced Resistance to Bacterial Blight in Rice Plant and Cell Physiology, 2012, 53(12): 2060-2072
  2. 2.0 2.1 2.2 2.3 Haiyan Ye;Hao Du;Ning Tang;Xianghua Li;Lizhong Xiong Identification and expression profiling analysis of TIFY family genes involved in stress and phytohormone responses in rice Plant Molecular Biology, 2009, 71(3): 291-305
  3. Staswick PE (2008) JAZing up jasmonate signaling. Trends Plant Sci 13:66–71

Structured Information