|
|
| (17 intermediate revisions by 2 users not shown) |
| Line 2: |
Line 2: |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| | + | |
| | ===Function=== | | ===Function=== |
| − | This gene, named DEEPER ROOTING 1 (DRO1), is a rice quantitative trait locus controlling root growth angle. It is negatively regulated by auxin and is involved in cell elongation in the root tip that causes asymmetric root growth and downward bending | + | [[File:FigureYL1.jpg|right|thumb|250px|'''Figure 1.''' ''Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference<ref name="ref1" />).'']] |
| | + | This gene, named DEEPER ROOTING 1 (DRO1), is a rice quantitative trait locus controlling root growth angle(Figure 1). It is negatively regulated by auxin and is involved in cell elongation in the root tip that causes asymmetric root growth and downward bending |
| | of the root in response to gravity. Higher expression of DRO1 increases the root growth angle, whereby roots grow in a more | | of the root in response to gravity. Higher expression of DRO1 increases the root growth angle, whereby roots grow in a more |
| | downward direction<ref name="ref1" />. | | downward direction<ref name="ref1" />. |
| − | [[File:Figure1.jpeg|right|thumb|350px|'''Figure 1.''' ''Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference<ref name="ref1" />).'']]
| + | |
| | '''GO assignment(s):''' GO:0009734 | | '''GO assignment(s):''' GO:0009734 |
| | + | ===Mutation=== |
| | + | Comparing the sequence of this ORF in the IR64 (a leading paddy cultivar widely grown in Asia, showed shallow rooting in an upland field) and KP (an upland cultivar from the Philippines, showed deep rooting) accessions identified a single 1-bp deletion within exon 4 in IR64 (Figure 2.), resulting in the introduction of a premature stop codon. Transforming an 8.7-kb genomic fragment of KP containing the candidate gene into IR64 increased the ratio of deep rooting (an index of downward root growth; Online Methods) compared to IR64 transformed with the vector control<ref name="ref1" />. |
| | + | [[File:FigureYL2.jpg|center|thumb|680px|'''Figure 2.''' ''Mutation and Structure of DRO1 based on annotation of Os09g0439800 (LOC_Os09g26840.1) (from reference<ref name="ref1" />).'']] |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | The predicted protein product of DRO1 has no similarity to known proteins. Genes found in monocots had higher homology to DRO1 than genes found in dicots, DRO1 is not predicted to encode a signal peptide or a transmembrane domain but is predicted to encode two putative N-myristoylation sites associated with lipid modification,suggesting that DRO1 is associated with a membrane protein or with the plasma membrane<ref name="ref1" />. |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| Line 24: |
Line 29: |
| | ==References== | | ==References== |
| | <references> | | <references> |
| − | <ref name="ref1">Yusaku Uga, Kazuhiko Sugimoto, Satoshi Ogawa, Jagadish Rane, Manabu Ishitani,et al. (2013) Control of root system architecture by DEEPER ROOTING 1 increases rice yield under drought conditions. Nature Genetics 45: 1097–1102. | + | <ref name="ref1">Yusaku Uga, Kazuhiko Sugimoto, Satoshi Ogawa, Jagadish Rane, Manabu Ishitani,et al. (2013) Control of root system architecture by DEEPER ROOTING 1 increases rice yield under drought conditions. Nature Genetics 45: 1097–1102. |
| | </ref> | | </ref> |
| | </references> | | </references> |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os09g0439800|
| |
| − | Description = Conserved hypothetical protein|
| |
| − | Version = NM_001069813.1 GI:115479368 GeneID:4347169|
| |
| − | Length = 3058 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os09g0439800, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
| |
| − | AP = Chromosome 9:16961491..16964548|
| |
| − | CDS = 16961864..16961883,16961980..16962151,16962243..16962721,16964085..16964163,16964280..16964285<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008402:16961491..16964548
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008402:16961491..16964548
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgaagattttcagctgggtagccaacaagatcagtgggaagcaagaagcaaatcggtttcccgcaaattcttctgcgccttaccgtgctaacgtgtcagattgtcgaaaggatgaattcagtgattggccccaatcattgcttgctattgggacatttggaaataagcagattgaggaggtagctcaggtggagaattcatccgacaatgtgcagtcagtgcaagataccgtcaaatttacagaggaagaagtagacaagatacggaaagaattcgaaacgctactagcaatcaaagatcaagcagaagctcaacgctcgcatgatgatgaccaagtaggtttacaaaagcgtgccgatggggaagacaatgagaagcatattagacagttgatcaacaaaaggatcattgtaagtaaatcaaagaattcgttaggaaagaaaggaaatacactcaagccgagatcagtcgcttcgttgctcaagttattcatgtgtaagggtggctttacctccgtagttccagaaccaaggaacacatttcctcaatcaagaatggagaagttgctcaaggcaatattgcagaagaaaatacacccgcaaaattcttccacgctagttgctaagaggcatttggactggaagccagatgagacagaaatcaatgagtgcctggaggatgcactgcgtgatctagacgatgatggtgcaaaatgggtcaaaactgattcagagtatattgtgcttgaaatgtaa</cdnaseq>|
| |
| − | AA = <aaseq>MKIFSWVANKISGKQEANRFPANSSAPYRANVSDCRKDEFSDWP QSLLAIGTFGNKQIEEVAQVENSSDNVQSVQDTVKFTEEEVDKIRKEFETLLAIKDQA EAQRSHDDDQVGLQKRADGEDNEKHIRQLINKRIIVSKSKNSLGKKGNTLKPRSVASL LKLFMCKGGFTSVVPEPRNTFPQSRMEKLLKAILQKKIHPQNSSTLVAKRHLDWKPDE TEINECLEDALRDLDDDGAKWVKTDSEYIVLEM</aaseq>|
| |
| − | DNA = <dnaseqindica>2666..2685#2398..2569#1828..2306#386..464#264..269#agatgaagtatagcaagctatcctacagccagccacgctgcaccgaaccctccaatccttggaacttgaaccccttcaaatcacacccagtaggctactagtagtacttctctgcaccaattccatcgccaatagcagccactacaagtcttacatctctcctttcctcctctctctgccattgctaggagcttgcatttcttggtagcttcatcagctagctgctttctccctccccaatctctcattcttcaggccaggatatgaaggtaaaggctcaaaccatcggtgtgattaatcatttcagagaggttaatagatttgaagtgttggtagtgttgatccatttcttgatggcatcatgaggcttgggttttctctgcagattttcagctgggtagccaacaagatcagtgggaagcaagaagcaaatcggtttcccgcaaattcttctgcgccttaccgtgagtgtacctgaactttcagtttccttgtaaattctttcagaactaaggtgattgttgttcaccaggcttcatgctgttcttatgaaatgtttccctgttccttgaggggagagggagagtacggacagtaatttggaagccgtttcctaatttgatattttctttctgtcattctgctgcagttataatgtctttacctcttagcagtttctgcttaggcatcatttgccttattcatttctggatacgatgatactttattgctttgtcctaatttaatcttttcctgctgtcattctgctccatttatggtgtctttacctcttagcagtttccgcttaggcatcatttgccatgttcatttctgaatatgctgatatactttgttgtcttggtagccatatacaagagtgaacgatttaaaggtttctcctaattgctagtaacagaacgcttttcgctctgcgattttctggattaccatcccctgattcctgagtaacctatcacaacgccaatgtgatggagcaaacattgatgtattatgacaatgttgtttctgatcctttgagaaaattttcttatatgcacttgggtgttgtttggaacgcaggaatttcactggaaacagttcaattatcgcacttccggaaaaaaaattcctgcattttaaacggcgctttaagttcagtaggagttttcaattttattttcctcttccctagcacgaaaagtgagagatttttgtgcatatgttatacccccaaaggactatttcatggcctgatgcccgccacgccaatatctctgtaaagcactgcttccaactagtcagtatgggtcaaagtcttgactaagtgcaaccctgcaagcaagtgtttccaactagtcagtatggcttcaattatttagttgatttataaccccaaccctccacttgtgaccaagaagaatttgatttgagcagacaatatcctgacctcggatggtttcgtaaatcgtactaaggaatcagatctgagccactagtccagctggactacagtacattatttatctctcaagattacataaaaagactactattgtacagagaatgcattgtttaagtggtaacaactgctgtgataagttattcctggtatacagaaaaatggcaggtgaaaacatcagggagtggagtaagcatgggcagacattgtacttaaagagtgataggccaatgagaatcactgggtgtttaaggattaaaaatttgtggtccatgctctagacatccaatttatgctaatatgaacttaggaccatatatttatgtttgtttactgatcttgcggcttaatcgagttctaatgcgcaggtgctaacgtgtcagattgtcgaaaggatgaattcagtgattggccccaatcattgcttgctattgggacatttggaaataagcagattgaggaggtagctcaggtggagaattcatccgacaatgtgcagtcagtgcaagataccgtcaaatttacagaggaagaagtagacaagatacggaaagaattcgaaacgctactagcaatcaaagatcaagcagaagctcaacgctcgcatgatgatgaccaagtaggtttacaaaagcgtgccgatggggaagacaatgagaagcatattagacagttgatcaacaaaaggatcattgtaagtaaatcaaagaattcgttaggaaagaaaggaaatacactcaagccgagatcagtcgcttcgttgctcaagttattcatgtgtaagggtggctttacctccgtagttccagaaccaaggaacacatttcctcaatcaagaatggagaaggtacacagtgaaattctttttttcttatgtaacatgataagttttacatactttctcgtcctcttattatcttatatgatgttcattgcagttgctcaaggcaatattgcagaagaaaatacacccgcaaaattcttccacgctagttgctaagaggcatttggactggaagccagatgagacagaaatcaatgagtgcctggaggatgcactgcgtgatctagacgatgatggtgcaaaatgggtcaaaactgattcagagtgtaagtagcatacttgcctatcatgaattgaaccttttcttttgccacttttgtcaatggagcaactgactgaatatgaacttttcttgtttccagatattgtgcttgaaatgtaaagttgggtgaatatgttagttcgttcatgccaggtatatacctttctttgatccccaaattttcaactcaactcaaatgtgaattatccttgatctagcatgtctctctgttttgatctgattagtgtgattccaatctgcaggttccaaaggtcctggcaagcttggggtttatggtgttactacgtaatgatataaatatgggatatagttagcaatgaagctctatgatcatgtaatgctcctccattatttctgacatgaaccatctgtaatttgaatcatgataaggaggttctgggacaaaggcctattccatgtgtctactctcttctgccctgaaactgtaaagaacgcattcaattttttcaac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069813.1 RefSeq:Os09g0439800]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
Figure 1. Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference[1]).
This gene, named DEEPER ROOTING 1 (DRO1), is a rice quantitative trait locus controlling root growth angle(Figure 1). It is negatively regulated by auxin and is involved in cell elongation in the root tip that causes asymmetric root growth and downward bending
of the root in response to gravity. Higher expression of DRO1 increases the root growth angle, whereby roots grow in a more
downward direction[1].
GO assignment(s): GO:0009734
Mutation
Comparing the sequence of this ORF in the IR64 (a leading paddy cultivar widely grown in Asia, showed shallow rooting in an upland field) and KP (an upland cultivar from the Philippines, showed deep rooting) accessions identified a single 1-bp deletion within exon 4 in IR64 (Figure 2.), resulting in the introduction of a premature stop codon. Transforming an 8.7-kb genomic fragment of KP containing the candidate gene into IR64 increased the ratio of deep rooting (an index of downward root growth; Online Methods) compared to IR64 transformed with the vector control[1].
Figure 2. Mutation and Structure of DRO1 based on annotation of Os09g0439800 (LOC_Os09g26840.1) (from reference[1]).
Expression
The predicted protein product of DRO1 has no similarity to known proteins. Genes found in monocots had higher homology to DRO1 than genes found in dicots, DRO1 is not predicted to encode a signal peptide or a transmembrane domain but is predicted to encode two putative N-myristoylation sites associated with lipid modification,suggesting that DRO1 is associated with a membrane protein or with the plasma membrane[1].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- National Institute of Agrobiological Sciences (NIAS), Tsukuba, Japan.
- International Center for Tropical Agriculture (CIAT), Cali, Colombia.
- Faculty of Science, University of Valle, Cali, Colombia.
References
- ↑ 1.0 1.1 1.2 1.3 1.4 Yusaku Uga, Kazuhiko Sugimoto, Satoshi Ogawa, Jagadish Rane, Manabu Ishitani,et al. (2013) Control of root system architecture by DEEPER ROOTING 1 increases rice yield under drought conditions. Nature Genetics 45: 1097–1102.
Structured Information