Difference between revisions of "Os10g0100200"

From RiceWiki
Jump to: navigation, search
(References)
 
(2 intermediate revisions by 2 users not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
===Function===
+
This gene encodes an Hypothetical protein. Some hypothetical proteins are well conserved among many organisms and presumably perform a common biological role that is as yet undefined. The other hypothetical proteins are specific to only one organism where they exert a specialized role. Functional assignment of hypothetical proteins is, therefore, indispensable for understanding the fundamental or specific biological phenomena of diverse organisms. Because the threedimensional structure of a protein is very important for the understanding of its function at the molecular level, structural analysis of hypothetical proteins can give valuable functional clues that may not be evident from sequence data alone.
Please input function information here.
 
  
 
===Expression===
 
===Expression===
Line 19: Line 18:
 
Please input cited references here.
 
Please input cited references here.
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os10g0100200|
 
Description = Hypothetical protein|
 
Version = NM_001070542.1 GI:115480827 GeneID:4347934|
 
Length = 791 bp|
 
Definition = Oryza sativa Japonica Group Os10g0100200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
 
AP = Chromosome 10:23934..24724|
 
CDS = 24293..24559|
 
GCID = <gbrowseImage1>
 
name=NC_008403:23934..24724
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008403:23934..24724
 
source=RiceChromosome10
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgtgcacggatttgccgccgcctgcttctcccctttcatcgtcgtcgtctacttgctgcacgagcccacctcgcgcacacggatttctcccacccccttcccccttgccgcctccgatgcctttgcctcgcgtgcgcacagttccaccttcgccgtcgccgaagaggcgctcggtgatacctgcgggagaaagaggaaggaggggagaggaggaagaagaagcagcgactgacatgtggggacccactgtgatagacttaaaatag</cdnaseq>|
 
AA = <aaseq>MCTDLPPPASPLSSSSSTCCTSPPRAHGFLPPPSPLPPPMPLPR                    VRTVPPSPSPKRRSVIPAGERGRRGEEEEEAATDMWGPTVIDLK</aaseq>|
 
DNA = <dnaseqindica>360..626#aggagcacggggaggagcactgctatggcaggtgaagacggtgcccgccccgccgctcgccgcagcctgccatagcatcatcctctggccgccctgccgccgcagccgccggcctccgctcgctacagcccgccgcctccgctcaccgcagccgttaccccgcctccgcccgccccgccactcgctgcaacctgtcacctcgcagcctgacgacggtgtcgaggtgggagaagggagacaaggcggcgtgaagggagtggtggcgctagcgagataggaaatgaggcggcagtggggccggcttcccctttcgccgtcgccgtagtcttcgtcatccctcgccgtcgccgtcgactcgcatgtgcacggatttgccgccgcctgcttctcccctttcatcgtcgtcgtctacttgctgcacgagcccacctcgcgcacacggatttctcccacccccttcccccttgccgcctccgatgcctttgcctcgcgtgcgcacagttccaccttcgccgtcgccgaagaggcgctcggtgatacctgcgggagaaagaggaaggaggggagaggaggaagaagaagcagcgactgacatgtggggacccactgtgatagacttaaaatagagtgggtagatggagaggctgttggagcgagtaagtagtttgactagccaaataagatggagagttggctatatgggtgtttggagagtccgatttggagaggctattggagatgctcttataactgatgagaattaattacagaatgataaaggtttagttgtc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070542.1 RefSeq:Os10g0100200]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 57: Line 24:
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Japonica Chromosome 10]]
 
[[Category:Chromosome 10]]
 
[[Category:Chromosome 10]]
 +
== Structured Information ==

Latest revision as of 08:43, 13 June 2015

Please input one-sentence summary here.

Annotated Information

This gene encodes an Hypothetical protein. Some hypothetical proteins are well conserved among many organisms and presumably perform a common biological role that is as yet undefined. The other hypothetical proteins are specific to only one organism where they exert a specialized role. Functional assignment of hypothetical proteins is, therefore, indispensable for understanding the fundamental or specific biological phenomena of diverse organisms. Because the threedimensional structure of a protein is very important for the understanding of its function at the molecular level, structural analysis of hypothetical proteins can give valuable functional clues that may not be evident from sequence data alone.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information