|
|
| (8 intermediate revisions by 2 users not shown) |
| Line 2: |
Line 2: |
| | | | |
| | ==Annotated Information== | | ==Annotated Information== |
| − | gene Os11g0116200 is one gene of Lipid transfer proteins (LTPs).while Lipid transfer proteins (LTPs) are highly conserved proteins in plants and play an important role in the resistance to pests, activation of resistance signalling, and adaptation to environmental stress.therefore,this gene palys a important role in pesticide-induced susceptibility.the other Lipid transfer proteins (LTPs) genes are Os012g0115100, Os10g0551700, Os10g0552600, Os11g0427800, Os12g0114800, Os11g0115100Os01g0822900, Os12g0114500.
| + | one gene of Lipid transfer proteins (LTPs) |
| | + | also one gene of Non-specific lipid-transfer protein |
| | | | |
| − | ===Expression=== | + | ==Function== |
| − | Please input expression information here.
| |
| | | | |
| − | ===Evolution===
| + | Gene Os11g0116200 is one gene of Lipid transfer proteins (LTPs).while Lipid transfer proteins (LTPs) are highly conserved proteins in plants and play an important role in the resistance to pests, activation of resistance signalling, and adaptation to environmental stress.therefore,this gene palys a important role in pesticide-induced susceptibility.the other Lipid transfer proteins (LTPs) genes are Os012g0115100, Os10g0551700, Os10g0552600, Os11g0427800, Os12g0114800, Os11g0115100Os01g0822900, Os12g0114500. |
| − | Please input evolution information here.
| |
| | | | |
| − | You can also add sub-section(s) at will.
| + | According to NCBI, gene Os11g0116200 is also a gene of Non-specific lipid-transfer protein.the function is Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. |
| | + | |
| | + | ==Laboratory== |
| | | | |
| | 1.School of Plant Protection, Yangzhou University, Yangzhou 220059, PR China | | 1.School of Plant Protection, Yangzhou University, Yangzhou 220059, PR China |
| | + | |
| | 2.Microbiology and Immunology Department, Georgetown University, Suite 603, 2115 Wisconsin Ave, NW, Washington, DC 2007, USA | | 2.Microbiology and Immunology Department, Georgetown University, Suite 603, 2115 Wisconsin Ave, NW, Washington, DC 2007, USA |
| | | | |
| − | ==References== | + | ==Research arctiles== |
| − | Please input cited references here.
| + | |
| | + | Yao Cheng,a Zhao-Peng Shi,a Li-Ben Jiang et al.Possible connection between imidacloprid-induced changes in rice gene transcription profiles and susceptibility to the brown plant hopper Nilaparvatalugens Stål (Hemiptera: Delphacidae)[J].Pesticide Biochemistry and Physiology.2012. |
| | + | |
| | + | International rice genome sequencing project (IRGSP).The map-based sequence of the rice genome.Nature 2005 |
| | | | |
| − | ==Structured Information==
| + | The rice annotation project (RAP).The rice annotation project database (RAP-DB): 2008 update. |
| − | {{JaponicaGene|
| |
| − | GeneName = Os11g0116200|
| |
| − | Description = Similar to Nonspecific lipid-transfer protein 1 (LTP 1) (Major allergen Pru d 3)|
| |
| − | Version = NM_001072118.2 GI:297611104 GeneID:4349606|
| |
| − | Length = 3991 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os11g0116200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
| |
| − | AP = Chromosome 11:721983..725973|
| |
| − | CDS = 722065..722411,725207..725258|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008404:721983..725973
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008404:721983..725973
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggctgcagttaactgcaaggtggtggtcgccgtgattgtggtggcgatggtggttgcggcgccgggggcgtcggcggcgataacgtgcgggcaggtgggatcggcgatcgcgccgtgcatctcgtacgtgacggggaggagcggcctcacgcagggatgctgcaacggagtgaaggggctgaacaacgccgcccgcaccaccgccgaccgccaggcggcctgccgctgcctcaagagcctcgccggcagcatcaagtcgctcaacctcggcaccgtcgccggcgtccccggcaagtgcggcgtcaacgtcggcttccccatcagcctctccaccgactgcaacaaccagccatgcggcggctgggtgacgtcgtggaggcgcctgcgctggtgctga</cdnaseq>|
| |
| − | AA = <aaseq>MAAVNCKVVVAVIVVAMVVAAPGASAAITCGQVGSAIAPCISYV TGRSGLTQGCCNGVKGLNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKCGV NVGFPISLSTDCNNQPCGGWVTSWRRLRWC</aaseq>|
| |
| − | DNA = <dnaseqindica>83..429#3225..3276#atcaccggcgacgaggagacactcactgatataatcaagctagctagcttaatcacctagctatccgtcagtttagctagatatggctgcagttaactgcaaggtggtggtcgccgtgattgtggtggcgatggtggttgcggcgccgggggcgtcggcggcgataacgtgcgggcaggtgggatcggcgatcgcgccgtgcatctcgtacgtgacggggaggagcggcctcacgcagggatgctgcaacggagtgaaggggctgaacaacgccgcccgcaccaccgccgaccgccaggcggcctgccgctgcctcaagagcctcgccggcagcatcaagtcgctcaacctcggcaccgtcgccggcgtccccggcaagtgcggcgtcaacgtcggcttccccatcagcctctccaccgactgcaacaagtatatcatctctctatgactcctctctctctctctatatatatatatacacgcatatatctctttattttttacgtgctatctaaatactccctccgtttcaggttataagacgttttaactttggttaaagttaaacttctctaagtttaactaattctgtagaaaaaagtaataatatttaaataccatcatagtttcattaaatccataattgaataaattttcataatatatttgtcatgggttaaaaaagatactacttttttactacaaaatcagtaaaacttacagtattttaactttaaccaaagtcaaaacgtcttataatctaaaatggagcaatagttaataaaaacttttacaagttaagatagattaccatatgtgagatatatctcacttcatagacataaaagattaaattcaacttatacaagttaaattaaaaaacaaactaaactaacactagttaacgtattttcgctattatatctgttattattgttacaacttgtacaagtttaatttaaacatgtatatttatggacatgcatatttaatattaatctatcttatcattttgttttactttttaatggctattaaggtggggggatgaaagcaacaatgagatatttctcgagatatgaaacattttcccataaaataactacctatatatatgcattttttttctttggtgcagggtcagctagatcaattaatcctgcttggatcgatcgatcgagcttaacacgctagctcgatcggagttgatcagctagtaattaagcacgtatttgctacagcatatatgaacaaagtaattaaaataacacctgcggcagacatgcagcgctccattctctctctgtatcagctgtatactttatgttgcacgctccctgtgtgcatgttctatcttaattttcttcagtatgtacacgatctgtgtgtactacgtgtaatcctatacgttttatgaattgcatgttgtccaaatgtctttgtcctagctactagctactccagcttcttgctgaggaaatctgcagtagtagtaatccctcgttgtgatacgcaacaaaattgtttaatgtgatcctgctatatatatagaaaatcatctctattattttacaggcataaaacaagtccactctaaaaacaattagtgcggccgttgtcttaatagacccgtatgtgaaaatcgtttttcacaagcagttccttaagacaacttcatgtatcattattgtagtatgtcaaaaagatgcaccacactatgcacagtcatacaaaatggcactactacacaactgatcttttatcgggatatccatttcggatagatttagaacgggtattagagatatttttaagcaccggttaccaaaaacatctttaattccgattggtgttataaccggtactaaagatgcctacagggctagtttaaaaagaaaacatccatatccatgtctgatgggtggagttggtggatggttacacgcgtgagggctgaggtgagagatcttgagttcgaatcacatatcccacacattttttttatttcgtatgcatctttagtaccggttatttcaactggtactaaagatcgagatatttagtctcgatttgttagaaccggttctacatctaaaacggttcccaactggtgctaaaaatgggttctccactagtgtggcaatacatttacattcacacattaaggattcacatcgtcacccatattcacgttgacactgtcttttaatgtataatttaaatgttcacattgtgaatattcgacaatgatagggagcccgatccctatctacaagtctaaacctaagattaatttgatcgacatgagctaatgaatagataagcgcactatctattgcttgaaatggtagatccattaatttccttttcatatatagattattgtaaaaagttgtcgttggctgattggaaatagacttgggcatgaaacctataccctctgcaactccacgtaatcgaaaatcatcctggaatagacccaaggatgaaatttagaccaaggaacgaaattgggcatctataagtgtggggagacaaaaataaacggtttcatagagttaaatgatcaaagttggaacaatattgcaatagttgatgattaaattaattaatgtggacttctttaaaccatatatagactgtgttcggcagcgctgttcctaacactaccagtacgcacgaaaaatgaaacggtccattagcgcgtgattaattaagtattagctattttttttaaaaaaaatgaattaatttgattttttttcaaacaactttcgtatagaaactttttaaaaaaacacaccgtttagcagtttcaaaagcgtgcgcacgaaaaacaagggaggagggttgagaaaaagggtgccgaagtattgtgcgctagatactggtaggggcattgttgtccatcctcggaagtggctcaaatataacgtgccacgacattagcgccatttcttacacgaaaacgaaacagggaaaactaattgaacaaatagagagatatgtagctagctagctttcagagtccactttttgagagagctcaatccaatgtgtggtttggctgcagcgacgaaccagaataatctcactctgctggtgcacccaatcaccaaatccaaaggaaattcaatgtacaacaaaattaaaaagaacatcttataatttgtctcctcctcctgcatatgcttgactcctagcttaactagaggtacctgcagccagccatgcggcggctgggtgacgtcgtggaggcgcctgcgctggtgctgacgccggcctccatgcagcaggccggcgggagggggagctccggcgccttggacgccagcatggtcgtcatcctcgccgcgctgctctgcgtcgtcatctgcgccctcggcctcacctccctcatccgctgcgcgctccactgcgcccgcggcctctcccccaccacggcgacgccgacgccgtcggtgtcgacagctgccacggccgggctgaagaagacggagctgaggaggattccggtggaggtgtacggcgccaagcaggccggcgtccccgacggcgagtgcgccatctgcctgggcgacttcgccgacggcgacaaggtgcgcgtgctcccgaggtgccaccacggcttccacgtccgctgcatcgacacgtggctcgccgcgcacacgtcctgccctacttgccgggactccattctctccgtccatggagtcgtcgccggcggccaaacatagctagtaatataatttcttgaacagaagaggtctaaaatgtaaatagaatataggtggtaaagtactccaaaattgggattgcgtaaatgcaagggattggacacaatgtttgaagtgtctctgtcacttggattatccatctgtttagctgtttctatgagttttctcctttaatttgtgtgctagcacatgatatttcccccaagattcgctgttcgtttgttctgggcataattttgtcaccactcaacaac</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072118.2 RefSeq:Os11g0116200]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
| Line 56: |
Line 31: |
| | [[Category:Japonica Chromosome 11]] | | [[Category:Japonica Chromosome 11]] |
| | [[Category:Chromosome 11]] | | [[Category:Chromosome 11]] |
| | + | ==Structured Information== |
Please input one-sentence summary here.
Annotated Information
one gene of Lipid transfer proteins (LTPs)
also one gene of Non-specific lipid-transfer protein
Function
Gene Os11g0116200 is one gene of Lipid transfer proteins (LTPs).while Lipid transfer proteins (LTPs) are highly conserved proteins in plants and play an important role in the resistance to pests, activation of resistance signalling, and adaptation to environmental stress.therefore,this gene palys a important role in pesticide-induced susceptibility.the other Lipid transfer proteins (LTPs) genes are Os012g0115100, Os10g0551700, Os10g0552600, Os11g0427800, Os12g0114800, Os11g0115100Os01g0822900, Os12g0114500.
According to NCBI, gene Os11g0116200 is also a gene of Non-specific lipid-transfer protein.the function is Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Laboratory
1.School of Plant Protection, Yangzhou University, Yangzhou 220059, PR China
2.Microbiology and Immunology Department, Georgetown University, Suite 603, 2115 Wisconsin Ave, NW, Washington, DC 2007, USA
Research arctiles
Yao Cheng,a Zhao-Peng Shi,a Li-Ben Jiang et al.Possible connection between imidacloprid-induced changes in rice gene transcription profiles and susceptibility to the brown plant hopper Nilaparvatalugens Stål (Hemiptera: Delphacidae)[J].Pesticide Biochemistry and Physiology.2012.
International rice genome sequencing project (IRGSP).The map-based sequence of the rice genome.Nature 2005
The rice annotation project (RAP).The rice annotation project database (RAP-DB): 2008 update.
Structured Information