Difference between revisions of "Os11g0117400"

From RiceWiki
Jump to: navigation, search
(Expression)
(References)
 
(13 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
RNA gel blot analysis indicated that OsWRKY89 was strongly induced by treatments of methyljasmonate and UV-B radiation. The transient expression analysis of the OsWRKY89–eGFP reporter in onion epidermal cells revealed that OsWRKY89 was targeted to nuclei. Transcriptional activity assays of OsWRKY89 and its mutants fused with a GAL4 DNA binding domain indicated that the 67 C-terminal aminoacids were required for the transcriptional activation and that the leucine zipper region at the N-terminus enhancedits transcriptional activity.
  
 
==Annotated Information==
 
==Annotated Information==
Line 14: Line 14:
 
Analyzing inducible expression pattern in T1 transgenic seedlings, the results showed: expression level of OsW89p::GUS can be increased by MeJA, IAA, ultraviolet, high temperature, low temperature and wounding treatment, inducible effects of MeJA and ultraviolet were distinct; and can be restrined by 2, 4-D; ABA and SA can't influence OsW89p::GUS expession; NaCl and PEG can restrain expression level of OsW89p::GUS in roots but increase expression level in leaves.GUS activity of OsW89p::GUS was higher than 35s::GUS in trangenic plants.In conclusion,we thought OsWRKY89 gene promoter was an inducible promoter with tissue specific expression characteristic<ref name="ref4" />.
 
Analyzing inducible expression pattern in T1 transgenic seedlings, the results showed: expression level of OsW89p::GUS can be increased by MeJA, IAA, ultraviolet, high temperature, low temperature and wounding treatment, inducible effects of MeJA and ultraviolet were distinct; and can be restrined by 2, 4-D; ABA and SA can't influence OsW89p::GUS expession; NaCl and PEG can restrain expression level of OsW89p::GUS in roots but increase expression level in leaves.GUS activity of OsW89p::GUS was higher than 35s::GUS in trangenic plants.In conclusion,we thought OsWRKY89 gene promoter was an inducible promoter with tissue specific expression characteristic<ref name="ref4" />.
  
RNA gel blot analysi s indicated thatOsWRK Y89was strongl y induc ed by treatme nts of methyl jasmon ate and UV-B  
+
RNA gel blot analysis indicated that OsWRK Y89 was strongly induced by treatments of methyl jasmonate and UV-B  
radiation . The transient expressi on analysis of the OsW RKY89–eG FP reporte r in onion epid ermal cel ls reve aled that OsWR KY89 was targeted to nuclei. Trans criptiona l activity assays of OsWR KY89 and its mutant s fused with a GA L4 DNA binding domain indicated that the 67 C-termina l amino acids were require d for the transcrip tional activation and that the leucine zipp er region at the N-term inus enhanc ed its tra nscriptio nal activit y. Ove rexpression of OsWRK Y89
+
radiation. The transient expression analysis of the OsWRKY89–eGFP reporter in onion epidermal cells revealed that OsWR KY89 was targeted to nuclei. Transcriptional activity assays of OsWRKY89 and its mutants fused with a GAL4 DNA binding domain indicated that the 67 C-terminal amino acids were required for the transcrip tional activation and that the leucine zipper region at the N-term inus enhanced its transcriptional activity. Overexpression of OsWRKY89 led to growth retardation at the early stage and reduction of internode length. Scanning electron microscopy revealed an increase in wax deposition on leaf surfaces of the OsWRKY89 overexpression lines and a decrease in wax loading in the RNAi-me diated OsW RKY89 suppression lines. Moreover, extractable and cell-wall-bound phenolic compounds were decreased in the overexpressor lines, but its SA levels were increased. Lignin staining showed an increase in lignification inculms of the overexpressor lines. Intere stingly, overexpression of the OsWRKY89 gene enhanced resistance to the rice blast fungus and white-backed planthop per as well as tolerance to UV-B irradia-tion. These results suggest that OsW RKY89 plays an important role in response to biotic and abiotic stresses<ref name="ref1" />.
led to growth retardation at the early stage and reduction of intern ode length. Scanni ng elect ron microscopy reve aled
+
 
an increas e in wax deposi tion on leaf surface s of the OsWR KY89 overexpre ssion lines and a decr ease in wax loading in the RNAi-me diated OsW RKY89 suppr ession lines. More over, extractabl e and cell-wa ll-bound phenol ic compo unds were decr eased in the overe xpressor lines, but its SA leve ls were increas ed. Ligni n staining showed an increas e in lignific ation in culms of the overe xpressor lines. Intere stingly, overexpre ssion of the OsWRKY89 gene enhanc ed resistanc e to the rice blast fungus and white-backe d planthop per as well as tolerance to UV-B irradia-tion. Th ese resu lts sugges t that OsW RKY89 plays an important rol e in resp onse to biotic and abiotic stresses<ref name="ref1" />.
 
 
[[File:图片1.png]]
 
[[File:图片1.png]]
 +
 +
The inducible expression characteristic of OsW89p in rice detected by GUS fluorometric measurement revealed that:1)Expression level of GUS was increased 4-fold by MeJA treatment, and repressed by the presence of 2, 4-D, but was not influenced by salicylic acid; 2)The expression of GUS was repressed in the roots and promoted in the leaves by NaCl and PEG;3)Ultraviolet, high temperature(42°C), low temperature(5°C)and injury treatments can increase the expression of GUS leaves, and the induced efficiency of ultraviolet was the highest<ref name="ref3" />.
  
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.
 +
 +
Accordingly, the rice genome has been pre-dicted to contain 1,611 transcription factors. However the genome of single-celled yeast Saccharomyces cerevi-sae contains only 12% of these genes. Thereby, indi-cating that evolution from primitive to complex life forms involves an increase or expansion in regulator genes. Sequence specific DNA-binding transcription regulators act in concert with other components of the transcriptional machinery to modulate the expression of specific target genes in temporal and spatial manner, necessary for normal development and proper response to physiological or
 +
environmental stimuli. Transcription factors are identified and classified according to their DNA-binding domains
 +
(DBDs) and therefore, the names of the DBDs, e.g., AP2/ERF (or EREBP), WRKY, NAC, are also used as thenames of the transcription factor families<ref name="ref5" />.
 +
 +
WRKY family shows evolution from simpler unicellular to more complex multicellular forms. As compared to pine, fern and moss, flowering plants, have the largest WRKY family, indicating that these transcription factors play an important
 +
regulatory role in flowering plants. The group III genes are greatly amplified in monocots and are most advanced in evolution and most successful in adaptability. The rice WRKY genes of group III are evolutionarily more active, as they evolved due to tandem and segmental gene duplication compared with those of Arabidopsis and therefore, may have specific roles in monocots<ref name="ref5" />.
  
 
===Knowledge Extension===
 
===Knowledge Extension===
Line 50: Line 58:
  
 
College of Agriculture and Biotechnology Zhejiang University, Hangzhou, P. R. China May. 2005
 
College of Agriculture and Biotechnology Zhejiang University, Hangzhou, P. R. China May. 2005
 +
 +
Central Salt and Marine Chemicals Research Institute, Council of Scientific and Industrial Research, Bhavnagar 364021, India
  
 
==References==
 
==References==
Line 64: Line 74:
 
<ref name="ref4">郝中娜 (2005).  
 
<ref name="ref4">郝中娜 (2005).  
 
   水稻 WRKY19 和 WRKY89 基因启动子的分析, 浙江大学.</ref>
 
   水稻 WRKY19 和 WRKY89 基因启动子的分析, 浙江大学.</ref>
 +
<ref name="ref5">Agarwal, P., M. Reddy, et al. (2011). "WRKY: its structure, evolutionary relationship, DNA-binding selectivity, role in stress tolerance and development of plants." Molecular biology reports 38(6): 3883-3896.</ref>
 
</references>
 
</references>
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os11g0117400|
 
Description = DNA-binding WRKY domain containing protein|
 
Version = NM_001072123.2 GI:297611109 GeneID:4349611|
 
Length = 1015 bp|
 
Definition = Oryza sativa Japonica Group Os11g0117400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:781474..782488|
 
CDS = 781474..781891,781997..782104,782198..782463|
 
GCID = <gbrowseImage1>
 
name=NC_008404:781474..782488
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:781474..782488
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgatagagcaccaaaaggctctcatggtggagctgcgtggcatggtcatgccattacttccgagcgacaatgaacaagccaagcttgctcttcaactcttgggagatatattgagttgctcagataaggctatctccatgctagaacttggtggagacactaaaaagctgaccaatcttgttggaggtaagagaaaaggtgacaagcatagcatggacaaccacaacttggaggaggaagccaaagaaagtgttagcaagagaagaaagaatgcagaacacacaggttcaactgtggctcaagcacctcacaatgatggacatcaatggaggaagtatggtcagaaatggatctctagagcaaaacattccaggagctactataggtgtgccaatagtaaagtgcaaggctgtcctgctacaaagacagtgcaacaaatggattccagtggaaatggaacatcaaagttgttcaacgttgactactatggccaacacacatgcaggggagatggcatagccgatccatatgttgtcgacacagcccatcacagtatggaacctatcaatcaaaacgaatgcaatagccctacacttgaacacgaagcccatgaagttcaagatgaaagatttgaaaacttgtgtatggtacaaaatatgccagagtatttgatagattttgaattggagagagccttcgagtttattgtgaactcaccattgggttctgagcattggacgttcgatgattcaataagatgtgagcacagtccaatatgcatatggggatga</cdnaseq>|
 
AA = <aaseq>MIEHQKALMVELRGMVMPLLPSDNEQAKLALQLLGDILSCSDKA                    ISMLELGGDTKKLTNLVGGKRKGDKHSMDNHNLEEEAKESVSKRRKNAEHTGSTVAQA                    PHNDGHQWRKYGQKWISRAKHSRSYYRCANSKVQGCPATKTVQQMDSSGNGTSKLFNV                    DYYGQHTCRGDGIADPYVVDTAHHSMEPINQNECNSPTLEHEAHEVQDERFENLCMVQ                    NMPEYLIDFELERAFEFIVNSPLGSEHWTFDDSIRCEHSPICIWG</aaseq>|
 
DNA = <dnaseqindica>598..1015#385..492#26..291#tagtgactgtcaagtagtgatcaacatgatagagcaccaaaaggctctcatggtggagctgcgtggcatggtcatgccattacttccgagcgacaatgaacaagccaagcttgctcttcaactcttgggagatatattgagttgctcagataaggctatctccatgctagaacttggtggagacactaaaaagctgaccaatcttgttggaggtaagagaaaaggtgacaagcatagcatggacaaccacaacttggaggaggaagccaaagaaagtgttagcaagagaaggtatatgtatataaatacatgccactagaggaatgtccactagcttatcattcattgctaacgaaatttgattgatcctcttgattatgatagaaagaatgcagaacacacaggttcaactgtggctcaagcacctcacaatgatggacatcaatggaggaagtatggtcagaaatggatctctagagcaaaacattccaggtataaatgagcatatgaactcctgtttatttccattcctcgaagcatattggttttatctaacagcaaaatatatacatctaatgagctcatttgcttaagcaggagctactataggtgtgccaatagtaaagtgcaaggctgtcctgctacaaagacagtgcaacaaatggattccagtggaaatggaacatcaaagttgttcaacgttgactactatggccaacacacatgcaggggagatggcatagccgatccatatgttgtcgacacagcccatcacagtatggaacctatcaatcaaaacgaatgcaatagccctacacttgaacacgaagcccatgaagttcaagatgaaagatttgaaaacttgtgtatggtacaaaatatgccagagtatttgatagattttgaattggagagagccttcgagtttattgtgaactcaccattgggttctgagcattggacgttcgatgattcaataagatgtgagcacagtccaatatgcatatggggatga</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072123.2 RefSeq:Os11g0117400]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 104: Line 83:
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 
[[Category:Chromosome 11]]
 +
==Structured Information==

Latest revision as of 09:01, 13 June 2015

RNA gel blot analysis indicated that OsWRKY89 was strongly induced by treatments of methyljasmonate and UV-B radiation. The transient expression analysis of the OsWRKY89–eGFP reporter in onion epidermal cells revealed that OsWRKY89 was targeted to nuclei. Transcriptional activity assays of OsWRKY89 and its mutants fused with a GAL4 DNA binding domain indicated that the 67 C-terminal aminoacids were required for the transcriptional activation and that the leucine zipper region at the N-terminus enhancedits transcriptional activity.

Annotated Information

Function

Please input function information here.

WRKY genes are a family of transcriptional regulatory factors that have specific functions in plants.Plant WRKY gene-encoded transcriptional regulators appear to be involved in various physiological programs, including disease-resistance,senescence,stress responses of biotic and abiotic, growth and development processes[1].

Expression

Please input expression information here.

Expression of OsW89p::GUS was observed in leaves, stems, and sheaths; pollens hadn't expression; mature seeds hadn't expression; the embryos of germinating seeds had expression; primary roots, adventitious roots and their lateral roots had expression but not in root tips of seedling stage; only lateral roots had expressin in roots of maturation phase[1].

Analyzing inducible expression pattern in T1 transgenic seedlings, the results showed: expression level of OsW89p::GUS can be increased by MeJA, IAA, ultraviolet, high temperature, low temperature and wounding treatment, inducible effects of MeJA and ultraviolet were distinct; and can be restrined by 2, 4-D; ABA and SA can't influence OsW89p::GUS expession; NaCl and PEG can restrain expression level of OsW89p::GUS in roots but increase expression level in leaves.GUS activity of OsW89p::GUS was higher than 35s::GUS in trangenic plants.In conclusion,we thought OsWRKY89 gene promoter was an inducible promoter with tissue specific expression characteristic[1].

RNA gel blot analysis indicated that OsWRK Y89 was strongly induced by treatments of methyl jasmonate and UV-B radiation. The transient expression analysis of the OsWRKY89–eGFP reporter in onion epidermal cells revealed that OsWR KY89 was targeted to nuclei. Transcriptional activity assays of OsWRKY89 and its mutants fused with a GAL4 DNA binding domain indicated that the 67 C-terminal amino acids were required for the transcrip tional activation and that the leucine zipper region at the N-term inus enhanced its transcriptional activity. Overexpression of OsWRKY89 led to growth retardation at the early stage and reduction of internode length. Scanning electron microscopy revealed an increase in wax deposition on leaf surfaces of the OsWRKY89 overexpression lines and a decrease in wax loading in the RNAi-me diated OsW RKY89 suppression lines. Moreover, extractable and cell-wall-bound phenolic compounds were decreased in the overexpressor lines, but its SA levels were increased. Lignin staining showed an increase in lignification inculms of the overexpressor lines. Intere stingly, overexpression of the OsWRKY89 gene enhanced resistance to the rice blast fungus and white-backed planthop per as well as tolerance to UV-B irradia-tion. These results suggest that OsW RKY89 plays an important role in response to biotic and abiotic stresses[2].

图片1.png

The inducible expression characteristic of OsW89p in rice detected by GUS fluorometric measurement revealed that:1)Expression level of GUS was increased 4-fold by MeJA treatment, and repressed by the presence of 2, 4-D, but was not influenced by salicylic acid; 2)The expression of GUS was repressed in the roots and promoted in the leaves by NaCl and PEG;3)Ultraviolet, high temperature(42°C), low temperature(5°C)and injury treatments can increase the expression of GUS leaves, and the induced efficiency of ultraviolet was the highest[3].

Evolution

Please input evolution information here.

Accordingly, the rice genome has been pre-dicted to contain 1,611 transcription factors. However the genome of single-celled yeast Saccharomyces cerevi-sae contains only 12% of these genes. Thereby, indi-cating that evolution from primitive to complex life forms involves an increase or expansion in regulator genes. Sequence specific DNA-binding transcription regulators act in concert with other components of the transcriptional machinery to modulate the expression of specific target genes in temporal and spatial manner, necessary for normal development and proper response to physiological or environmental stimuli. Transcription factors are identified and classified according to their DNA-binding domains (DBDs) and therefore, the names of the DBDs, e.g., AP2/ERF (or EREBP), WRKY, NAC, are also used as thenames of the transcription factor families[4].

WRKY family shows evolution from simpler unicellular to more complex multicellular forms. As compared to pine, fern and moss, flowering plants, have the largest WRKY family, indicating that these transcription factors play an important regulatory role in flowering plants. The group III genes are greatly amplified in monocots and are most advanced in evolution and most successful in adaptability. The rice WRKY genes of group III are evolutionarily more active, as they evolved due to tandem and segmental gene duplication compared with those of Arabidopsis and therefore, may have specific roles in monocots[4].

Knowledge Extension

Please input evolution information here.

You can also add sub-section(s) at will.

WRKY genes encode transcription factors that are involved in the regulation of various biological processes. These zinc-finger proteins, especially those members mediating stress responses, are uniquely expanded in plants[5].

The WRKY gene family, important for plant development and responses to both biotic and abiotic stresses, has encoun-tered several duplication and deletion events in very recent evolutionary history in Oryza sativa. Completing the annotation of this family in rice will enable the determination of whether these changes are simply neutral occurrences in a heavily redundant family of transcription factors or whether they ac-tively contributed to the variation between modern rice sub-species and cultivars. Mounting evidence indicates that WRKY genes modulate the signaling networks for all hormones and regulate the biosynthesis of starch, sesquiterpene, and alka-loids in a variety of plants, including important crops. There is no doubt that studies of this family of transcription factors will not only further our understanding of the fundamental pro-cesses that are controlled by WRKY genes, but also help en-hance agricultural productivity[5].

Labs working on this gene

Please input related labs here.

Department of Plant Pathology, State Key Laboratory of Agrobiotechnology, China Agricultural University, Yuanmenyuan West Rd. 2, Beijing 100094, China

Biotechnology Institute, Zhejiang University, Hangzhou 310029, China

Department of Biological Sciences, Hunan University of Science and Technology, Xiangtan 411201, China

Institute of Insect Sciences, Zhejiang University, Hangzhou 310029, China

Bioinformatics Core, School of Life Sciences, University of Nevada, Las Vegas, Nevada 89154, USA

College of Agriculture and Biotechnology Zhejiang University, Hangzhou, P. R. China May. 2005

Central Salt and Marine Chemicals Research Institute, Council of Scientific and Industrial Research, Bhavnagar 364021, India

References

  1. 1.0 1.1 1.2 郝中娜 (2005). 水稻 WRKY19 和 WRKY89 基因启动子的分析, 浙江大学.
  2. Haihua Wang;Junjie Hao;Xujun Chen;Zhongna Hao;Xia Wang;Yonggen Lou;Youliang Peng;Zejian Guo Overexpression of rice WRKY89 enhances ultraviolet B tolerance and disease resistance in rice plants Plant Molecular Biology, 2007, 65(6): 799-815.
  3. 郝中娜;王海华;郭泽建 水稻OsWRKY89基因启动子的表达特性 中国水稻科学, 2006, 20(2): 125-130.
  4. 4.0 4.1 Agarwal, P., M. Reddy, et al. (2011). "WRKY: its structure, evolutionary relationship, DNA-binding selectivity, role in stress tolerance and development of plants." Molecular biology reports 38(6): 3883-3896.
  5. 5.0 5.1 Christian A. Ross;Yue Liu;Qingxi J. Shen The WRKY Gene Family in Rice (Oryza sativa) Journal of Integrative Plant Biology, 2007, 49(6): 827-842.

Structured Information