Difference between revisions of "Os11g0490600"

From RiceWiki
Jump to: navigation, search
(Expression)
(Supplementary information)
 
(7 intermediate revisions by 3 users not shown)
Line 11: Line 11:
  
 
==  Mutation==
 
==  Mutation==
Mutations were also identified in the la1-Shiokari allele with a prostrate phenotype similar to la1-ZF802.
+
Mutations were also identified in the la1-Shiokari allele with a prostrate phenotype similar to la1-ZF802.[[File:Zhangshuling1.jpg]]
Sequence analysis revealed a single base substitute (TGG→TGA) at the second exon of LOC_Os03g03150 in tad1, which produces a premature stop codon. LOC_Os03g03150 is the TAD1 gene and the premature mutation is responsible for the phenotypes of the tad1 mutant plant.
+
Sequence analysis revealed a single base substitute (TGG→TGA) at the second exon of LOC_Os03g03150 in tad1, which produces a premature stop codon. LOC_Os03g03150 is the TAD1 gene and the premature mutation is responsible for the phenotypes of the tad1 mutant plant.[[File:Zhangshuling2.jpg]]
TAD1 is involved in regulating the exit of mitosis and it is indeed a functional cell-cycle switch protein homolo¬gous to Cdh1.
+
TAD1 is involved in regulating the exit of mitosis and it is indeed a functional cell-cycle switch protein homolo¬gous to Cdh1.[[File:Zhangshuling3.jpg]]
Mutation in LA1 results in a significant increase in PAT and thus impairs the IAA differential distribution in la1-ZF802, which ultimately leads to a reduced gravitropic  
+
Mutation in LA1 results in a significant increase in PAT and thus impairs the IAA differential distribution in la1-ZF802, which ultimately leads to a reduced gravitropic response in the mutant shoots.[[File:Zhangshuling4.jpg]]
response in the mutant shoots.
 
  
 
== Expression==
 
== Expression==
LA1 is a finely regulated temporally and spatially expressed gene, and that the region of its specific expression may play an important role in controlling the rice tiller angle.[[File:Zhangshuling5.jpg]][[File:Zhangshuling6.jpg]][[File:Zhangshuling7.jpg]]
+
LA1 is a finely regulated temporally and spatially expressed gene, and that the region of its specific expression may play an important role in controlling the rice tiller angle.[[File:Zhangshuling5.jpg]] [[File:Zhangshuling6.jpg]] [[File:Zhangshuling7.jpg]]
  
 
===Evolution===
 
===Evolution===
Line 36: Line 35:
 
7. Gutjahr C, Riemann M, Muller A, Duchting P, Weiler EW, Nick P. Cholodny-Went revisited: a role for jasmonate in gravitropism of rice coleoptiles. Planta 2005; 222:575-585.
 
7. Gutjahr C, Riemann M, Muller A, Duchting P, Weiler EW, Nick P. Cholodny-Went revisited: a role for jasmonate in gravitropism of rice coleoptiles. Planta 2005; 222:575-585.
 
8. Aloni R, Langhans M, Aloni E, Ullrich CI. Role of cytokinin in the regulation of root gravitropism. Planta 2004; 220:177-182.
 
8. Aloni R, Langhans M, Aloni E, Ullrich CI. Role of cytokinin in the regulation of root gravitropism. Planta 2004; 220:177-182.
 
+
9 Gutjahr C, Riemann M, Muller A, Duchting P, Weiler EW, Nick P. Cholodny-Went revisited: a role for jasmonate in gravitropism of rice coleoptiles. Planta 2005; 222:575-585.
 +
10 Aloni R, Langhans M, Aloni E, Ullrich CI. Role of cytokinin in the regulation of root gravitropism. Planta 2004; 220:177-182.
 +
11 Heilmann I, Shin J, Huang J, Perera IY, Davies E. Transient dissociation of polyribosomes and concurrent recruitment of calreticulin and calmodulin transcripts in gravistimulated maize pulvini. Plant Physiol 2001; 127:1193-1203.
 +
12 Belyavskaya NA. Changes in calcium signalling, gravitropism, and statocyte ultrastructure in pea roots induced by calcium channel blockers. J Gravit Physiol 2004; 11:P209-P210.
 +
13 Fasano JM, Swanson SJ, Blancaflor EB, Dowd PE, Kao TH, Gilroy S. Changes in root cap pH are required for the gravityresponse of the Arabidopsis root. Plant Cell 2001; 13:907-921.
 +
14 Monshausen GB, Sievers A. Basipetal propagation of gravityinduced surface pH changes along primary roots of Lepidium sativum L. Planta 2002; 215:980-988.
 +
15 Perera IY, Heilmann I, Chang SC, Boss WF, Kaufman PB. A role for inositol 1,4,5-trisphosphate in gravitropic signaling and the retention of cold-perceived gravistimulation of ooat shoot pulvini. Plant Physiol 2001; 125:1499-1507.
 +
16 Perera IY, Hung CY, Brady S, Muday GK, Boss WF. A universal role for inositol 1,4,5-trisphosphate-mediated signaling in plant gravitropism. Plant Physiol 2006; 140:746-760.
 +
17 Guan C, Rosen ES, Boonsirichai K, Poff KL, Masson PH. The ARG1-LIKE2 gene of Arabidopsis functions in a gravity signal transduction pathway that is genetically distinct from the PGM pathway. Plant Physiol 2003; 133:100-112.
 +
18 Sedbrook JC, Chen R, Masson PH. ARG1 (Altered Response to Gravity) encodes a DnaJ-like protein that potentially interacts with the cytoskeleton. Proc Natl Acad Sci USA 1999; 96:1140-1145.
 +
19 Went FW, Thimann KV, eds. Phytohormones. New York: Macmillan, 1937.
 +
20 Richard D, Firn, Wagstaff C, Digby J. The use of mutants to probe models of gravitropism. J Exp Bot 2000; 51:1323-1340.
 +
21 Sieberer T, Leyser O. Plant science: auxin transport, but in which direction? Science 2006; 312:858-860.
 +
22 Petrasek J, Mravec J, Bouchard R, et al. PIN proteins perform a rate-limiting function in cellular auxin efflux. Science 2006; 312:914-918.
 +
23 Okada K, Ueda J, Komaki MK, Bell CJ, Shimura Y. Requirement of the auxin polar transport system in early stages of Arabidopsis floral bud formation. Plant Cell 1991; 3:677-684.
 +
24 Luschnig C, Gaxiola RA, Grisafi P, Fink GR. EIR1, a root-specific protein involved in auxin transport, is required for gravitropism in Arabidopsis thaliana. Genes Dev 1998; 12:2175-2187.
 +
25 Galweiler L, Guan C, Muller A, et al. Regulation of polar auxin transport by AtPIN1 in Arabidopsis vascular tissue. Science 1998; 282:2226-2230.
 +
26 Muller A, Guan C, Galweiler L, et al. AtPIN2 defines a locus of Arabidopsis for root gravitropism control. EMBO J 1998; 17:6903-6911.
 +
27 Friml J, Wisniewska J, Benkova E, Mendgen K, Palme K. Lateral relocation of auxin efflux regulator PIN3 mediates tropism in Arabidopsis. Nature 2002; 415:806-809.
 +
28 Benjamins R, Quint A, Weijers D, Hooykaas P, Offringa R. The PINOID protein kinase regulates organ development in Arabidopsis by enhancing polar auxin transport. Development 2001; 128:4057-4067.
 +
29 Noh B, Bandyopadhyay A, Peer WA, Spalding EP, Murphy ASEnhanced gravi- and phototropism in plant mdr mutants mislocalizing the auxin efflux protein PIN1. Nature 2003; 423:999-1002.
 +
30 Wisniewska J, Xu J, Seifertova D, et al. Polar PIN localization directs auxin flow in plants. Science 2006; 312:883.
 +
31 Marchant A, Kargul J, May ST, et al. AUX1 regulates root gravitropism in Arabidopsis by facilitating auxin uptake within root apical tissues. EMBO J 1999; 18:2066-2073.
 +
32 Yang Y, Hammes UZ, Taylor CG, Schachtman DP, Nielsen E. High-affinity auxin transport by the AUX1 influx carrier protein. Curr Biol 2006; 16:1123-1127.
 +
33 Terasaka K, Blakeslee JJ, Titapiwatanakun B, et al. PGP4, an ATP binding cassette P-glycoprotein, catalyzes auxin transport in Arabidopsis thaliana roots. Plant Cell 2005; 17:2922-2939.
 +
34 Overbeek JV. “Lazy”, an a-geotropic form of maize. J Heredity 1936; 27:93-96.
  
 
== Supplementary information==
 
== Supplementary information==
 
It is linked to the online version of the paper on the Cell Research website.
 
It is linked to the online version of the paper on the Cell Research website.
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os11g0490600|
 
Description = Conserved hypothetical protein|
 
Version = NM_001074458.1 GI:115485564 GeneID:4350543|
 
Length = 5524 bp|
 
Definition = Oryza sativa Japonica Group Os11g0490600, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:19145382..19150905|
 
CDS = 19145410..19145415,19145782..19145851,19147818..19148686,19150064..19150349,19150566..19150585<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008404:19145382..19150905
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:19145382..19150905
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgaagctcttaggttggatgcatcgaaagctacggagtaataatgacgtgttcaaagagttcaacaccggaggaggtggggcctgcaactgcatcaccgggcttgcctcgcctgaccacgacaacgactacttctccggcgacgacgccgcccacgcctcgccgccggtcaccgccggcgacctcttcaccttcggcggcagcggccttctcaccatcggcacgctaggcatcgccgccgtcgccattcccagcggcggcgacgacgacgactacgacatcgacttcgaggtggacgccaccagcgacgacgacggcggcttcaccgtcgaggacgacgacgccgacgtcggcggcgccgtcacgcccaccttcaccttccccgcggcgacggcggcggaggcggtcgtcgccaccgtggagaaggcagtggccgcggtggaggcgatcgcggagaaggacgacgacaccaccacggaggacgacctgatggtggtgagcgccgagctggagaaggtgctcggcggcgtcgacgtggcgtcggcgcgggtgagcttcgccatgggcggtggcgtcgactgcccgctccagggcttcctgttcggctccccggtgagcgacgtcgagtcgcgcccggagtacctgcaggcgccgcgggactcgtccggctcctgcggcggcggcgggcggcgcacctcgctcggcgagctgttcatgcgcacccgcttcgccgacgagaaggtggcgctcgtcgccgtcgccgagggcgaggacggcgtcgccggcgacgacggcgctgctgctgccggcgtcggcggagacagagcggggaaaggcggcggctacaagacgatgaagaagaggaaggtgaaggacgagaaaggcggcggcggcgccgccggcggtggaatgccggcgacggtgacgaagagcaagtttcagaagatccttcaaatcttccacaggaaagtctaccccgagaacacactcctcacaaggaatctgaccaagaagagccgcaaccgcggcgccaccgataatggcggtggcgccgtggccaccggagaccccgacgggcctctggcctcgccggtgctccggtgccggaaggaccatcccatgaggggcttcggctgctgcaccaatggcgccttcggtgcatcgtcaccgggaggcaacgccgagatgaacggcaacaagagcggccactggatcaagactgatgccgactacttggtgctggaattataa</cdnaseq>|
 
AA = <aaseq>MKLLGWMHRKLRSNNDVFKEFNTGGGGACNCITGLASPDHDNDY                    FSGDDAAHASPPVTAGDLFTFGGSGLLTIGTLGIAAVAIPSGGDDDDYDIDFEVDATS                    DDDGGFTVEDDDADVGGAVTPTFTFPAATAAEAVVATVEKAVAAVEAIAEKDDDTTTE                    DDLMVVSAELEKVLGGVDVASARVSFAMGGGVDCPLQGFLFGSPVSDVESRPEYLQAP                    RDSSGSCGGGGRRTSLGELFMRTRFADEKVALVAVAEGEDGVAGDDGAAAAGVGGDRA                    GKGGGYKTMKKRKVKDEKGGGGAAGGGMPATVTKSKFQKILQIFHRKVYPENTLLTRN                    LTKKSRNRGATDNGGGAVATGDPDGPLASPVLRCRKDHPMRGFGCCTNGAFGASSPGG                    NAEMNGNKSGHWIKTDADYLVLEL</aaseq>|
 
DNA = <dnaseqindica>29..34#401..470#2437..3305#4683..4968#5185..5204#atcttagcacgctaaaccggcttccaagatgaaggttagtgtttcatctattgaacatatccatgcttattagtttcgtaatgtagatactaagtttatgtatatgtagttctcttttggaacttgagttgttaatttctttttgtaaatattttttgtttggtttggttacgttgctggcctagctgatcatgctttctgggttgaataaatgtagctacaactattaatcctttattttgtttttccatcattgccgttgtcatcatctttcattgtcatcatcatcttctccttttgacgatcttcatcagatcttgatcaaaagtaatagaccatgcattttcatgattgatgaagttcataaaaatttctgatcctcatatgtgtatatgatcagctcttaggttggatgcatcgaaagctacggagtaataatgacgtgttcaaagagttcaacaccggaggaggtatgcacgcacaacttaattaatctattttttgtcctttttttcttatgtttaattgatgaagtataattgttttgaaaaatacagtagctcgtaacacaaacgcactcacctctagtactctctccagtgtttttatatattaaactaacgtcatataaaaaattgaagttagtatatatgtataatagttcatcggtacatgcagaaaaaaaaaagagtttgtctctggttttagatctgtaagcatgcccacaataatgagaaaaccactgcaaaattgttggccggccggtcccacatgtcattgaccagattagccgtctgaagtgctgaactgtatggaacactagcaatcatcaatgggagttttgcactcttgcgcttggtcacattggagatggcacatctatctataatatcacacatgccacttttcttccagcctcaatatctatagttccagcactagctagctagctagaccaactattgcatagcaagaaccctatattatcattttgcagataacattttcttttccatgtagtaacattgccatggaaagatcacgagggcatgtctatcttttgtgaaactctctctctctccttttgaaggcttcctttgagagttttctccttgttggactgttgctcttaggctcagcatgttaatatcagagttttcgcccgtttttcataaatcaattgtgccgttgtaagatttttgcgtccagttttccttataaactggacctctctgcctgtttcctcgagaaaaattgtccaagagcattctcgacgattcaacaactagaattcaacaaataaagatttttatatatggtgcatatggtacggtgagatattgtatttttagtgtgagataccaaaagagctacaacaaattaatacgataaaataagggaaatttcatggactaactagttagaaacatattttgagtaaatgaaaattttattttattaccttggtttacaaaagacttataataagtgctgtcaaacatctaaaatgttaaattcttaatagacgaaaagtattagaatttaaaacgtgaaaattatatactttttgatgaaaaatagtaggaatgtgaaaattatattagtagactttttttgatgaaaactctttcatatagttatatgttaattttttataactatatagtttgagaaagtaatcatataacttttgcattaaaaaatgtgtcaatgtccaaaacattatcttaattaacccggtccttctcctcccaaaggaacacataaaaaaggacaaaaaccaatacatcttgaaaaacttacatagaaaaagcttaatcatattttatatcaccctgatcccgttgcaacgcacatgaatgtaactatttctttttaaaatggtgttgtacttcataaatttgaaacaaaaaaaatacatataatgtaacccttttaatttctgaaacacatcaaaacttttctttctcaaaaaaaagaaaagaaaacacatgaaagcctgcataattttgcatgcaaatgatcgtactccttcctttttaaggttacaagactttcttacattacccaaatttatatagataataaatctagacacaaatatatgtgatttattaatatgtatatgaatgtgaacaatgccaaaaagtcttataatataaaatggagaaagtatttaatactccctcagtttctaaatatttgacaccattgattttttaaacatgtttaatcattcgtcttattcaaaaattttaagtaattattaattattttcctatcatttgattcattgttaaatatacttttatgtatacatataattttacgtatttcacaaaagtttttgataagacggacggtcaaacatgtgctaaaaagtcaactgtgtcagatatttagaaacggagggagtaattcactgtgtgactgcaggtggggcctgcaactgcatcaccgggcttgcctcgcctgaccacgacaacgactacttctccggcgacgacgccgcccacgcctcgccgccggtcaccgccggcgacctcttcaccttcggcggcagcggccttctcaccatcggcacgctaggcatcgccgccgtcgccattcccagcggcggcgacgacgacgactacgacatcgacttcgaggtggacgccaccagcgacgacgacggcggcttcaccgtcgaggacgacgacgccgacgtcggcggcgccgtcacgcccaccttcaccttccccgcggcgacggcggcggaggcggtcgtcgccaccgtggagaaggcagtggccgcggtggaggcgatcgcggagaaggacgacgacaccaccacggaggacgacctgatggtggtgagcgccgagctggagaaggtgctcggcggcgtcgacgtggcgtcggcgcgggtgagcttcgccatgggcggtggcgtcgactgcccgctccagggcttcctgttcggctccccggtgagcgacgtcgagtcgcgcccggagtacctgcaggcgccgcgggactcgtccggctcctgcggcggcggcgggcggcgcacctcgctcggcgagctgttcatgcgcacccgcttcgccgacgagaaggtggcgctcgtcgccgtcgccgagggcgaggacggcgtcgccggcgacgacggcgctgctgctgccggcgtcggcggagacagagcggggaaaggcggcggctacaagacgatgaagaagaggaaggtgaaggacgagaaaggcggcggcggcgccgccggcggtggaatgccggcgacggtgacgaagagcaagtttcagaaggtaacttttttttttgttgttgctagcattttaatttgctttgaagaaaactataaaatatctgcaattttggctgactatttcatgaggtttccttggatatgatcatttgattaattagttcgttcgattgctatagttttagttcatttttctttaattaatttgtaataaaactcaagagttattgtgagttttttttttattatttttgcttcagtacgtgcattttctactagtgaaacttcaatattaaccaggccagtcgacatttcttaattgtgatttgatttaagggtcaagattagaactatagattgaatatgcaaagtttcagctcggacgacatttgaacatttgactaattatatatttccgagttcaattgtttgccggtaaaattctgaacttgcagttggaacattcaagattcaactctgattcacatgatctcgaactcaatatctccaactttataaaaagacaaaaagattactgctcaacggtgagtttaatgaaggaatgctcatcacagcaaatccataattctatataactctctgtaatatgtaatggtaagaaacagatattcatgattaaatcatttttccccttcagaaagaaatactgatttttcgtggtacatccaaaattactccaaagtttacactgaatttcacgctgttcttggtgtttaagattaattttaggtagatattttctagtcccgcaacaaagctgacaatgaaaaccccaaaactaatcctaaatgaaattctaaaattaagaaaaacagctttagattataaattttaatagtaagtccaaggaaatagccagcaatgttaataagattgctgataagaatatataacagtttggagccaatccatttcacatgtgtatcctgctctgggacataagtagacacaaatcccgagttttgactatcatctcataatcggaagatctttcactgtgtcgtcagattcgagttaagtttctgtagaccaacttggtgtgtcaatggtgttgttaggagtggggatactgggggcagtgagttgacatgcgatttgtttgcaatctcctgtctaatgctatctttatggatcatttcatttgtcatttttcgtttgccccataaacaacaagggattcttgatttgatatattatacatccttctaggtgctctcttgcatttcttttccttggagagatgctccaaatatccctcaaaagaaattctagattccttttgctactacttggtacttacatttaattttgttacaacgaatgaaagaaactgagtttcagaaagtgatcaaaagttgacaatgttctgaaatgaggaaacatctgctcattgcagatccttcaaatcttccacaggaaagtctaccccgagaacacactcctcacaaggaatctgaccaagaagagccgcaaccgcggcgccaccgataatggcggtggcgccgtggccaccggagaccccgacgggcctctggcctcgccggtgctccggtgccggaaggaccatcccatgaggggcttcggctgctgcaccaatggcgccttcggtgcatcgtcaccgggaggcaacgccgagatgaacggcaacaagagcggccactggatcaagactgatgccgactgtgagtagcactgcacaccttggtgtctccatccatcttcaatggatctatctttgcaatcatgcattcagtcttgacagctacatctttccatactatttttggggaatcttccaagagctatccatcactagtttctgagttactgtgtgctgatgcacacactgcaaacattgtgctttttcactgaaaccctgtctctctgatctgatgcagacttggtgctggaattataatggggaaaagaagaggagctatttgtttcatcaagaattaaagcttgaatagtgagcatctcatatatatgaatatgtgcttgctgttacaatataatctctatctgtttggtatagaagggcttgaatgtgctgtatatgtcactatatattgggggggagaggattactatgagatcaactcataagtgtgtggtgtttatatacattgctctgtgaatgtatgacagagatcagaacttaatgtattgtatgctttcttgatgtgattggtgtttatgagcctagctgatggcaatattgtgtgtgggtccacccct</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074458.1 RefSeq:Os11g0490600]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 79: Line 71:
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 
[[Category:Chromosome 11]]
 +
== Structured Information ==

Latest revision as of 09:07, 13 June 2015

Please input one-sentence summary here.

Annotated Information

Function

LAZY1 (LA1) gene regulates shoot gravitropism by which the rice tiller angle is controlled. LA1, a novel grass-specific gene, is temporally and spatially expressed, and plays a negative role in polar auxin transport (PAT). Loss-of-function of LA1 enhances PAT greatly and thus alters the endogenous IAA distribution in shoots, leading to thereduced gravitropism, and therefore the tiller-spreading phenotype of rice plants. LA1 is an essential regulator of tiller angle of rice, opening a promising way for breeders to develop elite rice cultivars and other cereal crops with optimal plant architecture. LA1ΔN100 is the truncated LA1 with a deletion of amino-acid residues1-100 that contain a predicted transmembrane domain. LA1ΔNLS refers to the LA1 truncated from amino-acid residues 286 to 312, a segment containing a putative nuclear localization signal (NLS) domain. The 996-1571 bp region of the LA1 gene was subcloned into the T-easy vector and used as templates to generate sense and antisense RNA probes. Rice LA1gene is responsible for the tiller-spreading phenotype of mutant plants.

Mutation

Mutations were also identified in the la1-Shiokari allele with a prostrate phenotype similar to la1-ZF802.Zhangshuling1.jpg Sequence analysis revealed a single base substitute (TGG→TGA) at the second exon of LOC_Os03g03150 in tad1, which produces a premature stop codon. LOC_Os03g03150 is the TAD1 gene and the premature mutation is responsible for the phenotypes of the tad1 mutant plant.Zhangshuling2.jpg TAD1 is involved in regulating the exit of mitosis and it is indeed a functional cell-cycle switch protein homolo¬gous to Cdh1.Zhangshuling3.jpg Mutation in LA1 results in a significant increase in PAT and thus impairs the IAA differential distribution in la1-ZF802, which ultimately leads to a reduced gravitropic response in the mutant shoots.Zhangshuling4.jpg

Expression

LA1 is a finely regulated temporally and spatially expressed gene, and that the region of its specific expression may play an important role in controlling the rice tiller angle.Zhangshuling5.jpg Zhangshuling6.jpg Zhangshuling7.jpg

Evolution

LA1 may represent a new type of regulating proteins that shuttle between the plasma membrane and the nucleus. Further investigations of LA1 functions will allow for a better understanding of the mechanism underlying the monocotyledonous shoot gravitropism.

Labs working on this gene

1、State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China; 2、State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, China

References

1. Morita MT, Tasaka M. Gravity sensing and signaling. Curr Opin Plant Biol 2004; 7:712-718. 2. Perbal G, Driss-Ecole D. Mechanotransduction in gravisensing cells. Trends Plant Sci 2003; 8:498-504. 3.Fukaki H, Wysocka-Diller J, Kato T, Fujisawa H, Benfey PN Tasaka M. Genetic evidence that the endodermis is essential for shoot gravitropism in Arabidopsis thaliana. Plant J 1998; 14:425-430. 4. Tsugeki R, Olson ML, Fedoroff NV. Transposon tagging and the study of root development in Arabidopsis. Gravit Space Biol Bull 1998; 11:79-87. 5. Moore I. Gravitropism: lateral thinking in auxin transport. CurrBiol 2002; 12:452-454. 6. Kim SK, Chang SC, Lee EJ, et al. Involvement of brassinosteroids in the gravitropic response of primary root of maize. Plant Physiol 2000; 123:997-1004. 7. Gutjahr C, Riemann M, Muller A, Duchting P, Weiler EW, Nick P. Cholodny-Went revisited: a role for jasmonate in gravitropism of rice coleoptiles. Planta 2005; 222:575-585. 8. Aloni R, Langhans M, Aloni E, Ullrich CI. Role of cytokinin in the regulation of root gravitropism. Planta 2004; 220:177-182. 9 Gutjahr C, Riemann M, Muller A, Duchting P, Weiler EW, Nick P. Cholodny-Went revisited: a role for jasmonate in gravitropism of rice coleoptiles. Planta 2005; 222:575-585. 10 Aloni R, Langhans M, Aloni E, Ullrich CI. Role of cytokinin in the regulation of root gravitropism. Planta 2004; 220:177-182. 11 Heilmann I, Shin J, Huang J, Perera IY, Davies E. Transient dissociation of polyribosomes and concurrent recruitment of calreticulin and calmodulin transcripts in gravistimulated maize pulvini. Plant Physiol 2001; 127:1193-1203. 12 Belyavskaya NA. Changes in calcium signalling, gravitropism, and statocyte ultrastructure in pea roots induced by calcium channel blockers. J Gravit Physiol 2004; 11:P209-P210. 13 Fasano JM, Swanson SJ, Blancaflor EB, Dowd PE, Kao TH, Gilroy S. Changes in root cap pH are required for the gravityresponse of the Arabidopsis root. Plant Cell 2001; 13:907-921. 14 Monshausen GB, Sievers A. Basipetal propagation of gravityinduced surface pH changes along primary roots of Lepidium sativum L. Planta 2002; 215:980-988. 15 Perera IY, Heilmann I, Chang SC, Boss WF, Kaufman PB. A role for inositol 1,4,5-trisphosphate in gravitropic signaling and the retention of cold-perceived gravistimulation of ooat shoot pulvini. Plant Physiol 2001; 125:1499-1507. 16 Perera IY, Hung CY, Brady S, Muday GK, Boss WF. A universal role for inositol 1,4,5-trisphosphate-mediated signaling in plant gravitropism. Plant Physiol 2006; 140:746-760. 17 Guan C, Rosen ES, Boonsirichai K, Poff KL, Masson PH. The ARG1-LIKE2 gene of Arabidopsis functions in a gravity signal transduction pathway that is genetically distinct from the PGM pathway. Plant Physiol 2003; 133:100-112. 18 Sedbrook JC, Chen R, Masson PH. ARG1 (Altered Response to Gravity) encodes a DnaJ-like protein that potentially interacts with the cytoskeleton. Proc Natl Acad Sci USA 1999; 96:1140-1145. 19 Went FW, Thimann KV, eds. Phytohormones. New York: Macmillan, 1937. 20 Richard D, Firn, Wagstaff C, Digby J. The use of mutants to probe models of gravitropism. J Exp Bot 2000; 51:1323-1340. 21 Sieberer T, Leyser O. Plant science: auxin transport, but in which direction? Science 2006; 312:858-860. 22 Petrasek J, Mravec J, Bouchard R, et al. PIN proteins perform a rate-limiting function in cellular auxin efflux. Science 2006; 312:914-918. 23 Okada K, Ueda J, Komaki MK, Bell CJ, Shimura Y. Requirement of the auxin polar transport system in early stages of Arabidopsis floral bud formation. Plant Cell 1991; 3:677-684. 24 Luschnig C, Gaxiola RA, Grisafi P, Fink GR. EIR1, a root-specific protein involved in auxin transport, is required for gravitropism in Arabidopsis thaliana. Genes Dev 1998; 12:2175-2187. 25 Galweiler L, Guan C, Muller A, et al. Regulation of polar auxin transport by AtPIN1 in Arabidopsis vascular tissue. Science 1998; 282:2226-2230. 26 Muller A, Guan C, Galweiler L, et al. AtPIN2 defines a locus of Arabidopsis for root gravitropism control. EMBO J 1998; 17:6903-6911. 27 Friml J, Wisniewska J, Benkova E, Mendgen K, Palme K. Lateral relocation of auxin efflux regulator PIN3 mediates tropism in Arabidopsis. Nature 2002; 415:806-809. 28 Benjamins R, Quint A, Weijers D, Hooykaas P, Offringa R. The PINOID protein kinase regulates organ development in Arabidopsis by enhancing polar auxin transport. Development 2001; 128:4057-4067. 29 Noh B, Bandyopadhyay A, Peer WA, Spalding EP, Murphy ASEnhanced gravi- and phototropism in plant mdr mutants mislocalizing the auxin efflux protein PIN1. Nature 2003; 423:999-1002. 30 Wisniewska J, Xu J, Seifertova D, et al. Polar PIN localization directs auxin flow in plants. Science 2006; 312:883. 31 Marchant A, Kargul J, May ST, et al. AUX1 regulates root gravitropism in Arabidopsis by facilitating auxin uptake within root apical tissues. EMBO J 1999; 18:2066-2073. 32 Yang Y, Hammes UZ, Taylor CG, Schachtman DP, Nielsen E. High-affinity auxin transport by the AUX1 influx carrier protein. Curr Biol 2006; 16:1123-1127. 33 Terasaka K, Blakeslee JJ, Titapiwatanakun B, et al. PGP4, an ATP binding cassette P-glycoprotein, catalyzes auxin transport in Arabidopsis thaliana roots. Plant Cell 2005; 17:2922-2939. 34 Overbeek JV. “Lazy”, an a-geotropic form of maize. J Heredity 1936; 27:93-96.

Supplementary information

It is linked to the online version of the paper on the Cell Research website.

Structured Information