|
|
| (4 intermediate revisions by 2 users not shown) |
| Line 12: |
Line 12: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | a Department of Plant Pathology, Kansas State University, Manhattan, Kansas 66506 |
| | + | b Department of Genetics, Development, and Cell Biology, Iowa State University, Ames, Iowa 50011 |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| + | Ginny Antony;Junhui Zhou;Sheng Huang;Ting Lib;Bo Liu;Frank White;Bing Yang |
| | + | Rice xa13 Recessive Resistance to Bacterial Blight Is Defeated by Induction of the Disease Susceptibility Gene Os-11N3 |
| | + | The Plant Cell, 2010, 22(11): 3864-3876 |
| | | | |
| − | ==Structured Information==
| |
| − | {{JaponicaGene|
| |
| − | GeneName = Os11g0508600|
| |
| − | Description = Similar to MtN3 protein precursor|
| |
| − | Version = NM_001074487.2 GI:297611883 GeneID:4350572|
| |
| − | Length = 2772 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os11g0508600, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − |
| |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
| |
| − | AP = Chromosome 11:19998168..20000939|
| |
| − | CDS = 19998520..19998849,19999002..19999121,19999221..19999593,19999890..19999926,20000660..20000711<br>|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008404:19998168..20000939
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008404:19998168..20000939
| |
| − | source=RiceChromosome11
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggctggcatgtctcttcagcatccctgggccttcgcctttggtctcctaggcaacatcatctccttcatgacctacctggccccactgccgacgttctacaggatctacaagagcaagtcgacgcaggggttccagtcggtaccctacgtggtggcgctgttcagcgcgatgctgtggatctactacgcgctgctcaagtccgacgagtgcctcctcatcaccatcaactccgctggctgcgtcatcgagaccatctacatcgccgtctacctcgtctacgcccccaagaaggccaagatgttcaccgccaagctcctcctcctcgtcaacgtcggcgtcttcggcctcatcctcctcctcaccctcctcctctccgccggcgaccgccgcatcgtggttcttggttgggtctgcgttggcttctccgtcagcgtcttcgtcgccccccttagcatcatcaggctggtggtgcgcaccaagagcgtggagttcatgccgttctcgctctccttctccctcaccatcagcgccgtcgtctggttcctctacggcctcctcatcaaggacaaatatgtcgctcttcccaacgtgctgggcttctccttcggcgtcatccagatggggctgtacgccatgtacaggaactcgacgcccaaggccgtgctgaccaaggaggtcgaggcggcgacggccaccggcgacgacgaccactccgccgccggcgtcaaggagcacgtcgtcaacatcgccaagctctctgccgccgtcgacgtcgtcaagacccgcgaggtgcaccccgtcgacgtcgagtccccgccggcagaggcgccgcctgaggaggacgacaaggccgccgccgccaccgccgccgccgtcgccggcgccggcgagaagaaggtagctgcatga</cdnaseq>|
| |
| − | AA = <aaseq>MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQG FQSVPYVVALFSAMLWIYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMF TAKLLLLVNVGVFGLILLLTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRT KSVEFMPFSLSFSLTISAVVWFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNST PKAVLTKEVEAATATGDDDHSAAGVKEHVVNIAKLSAAVDVVKTREVHPVDVESPPAE APPEEDDKAAAATAAAVAGAGEKKVAA</aaseq>|
| |
| − | DNA = <dnaseqindica>2091..2420#1819..1938#1347..1719#1014..1050#229..280#atcaagccttcaagcaaagcaaactcaagtagtagctgattaccagctcttctctcttctcattgagaagagggaattaagttttgatctctgctttattgcctgatcatcctcttgttacttgcaagcaagaacagtagtgtactgtgcctcattgatctcctcccaccaaactctctctctctctctcatattccgagctagctagttaatcaagatcttgctgcaatggctggcatgtctcttcagcatccctgggccttcgcctttggtctcctaggtgtgttgcctttgatctgatccaaggaattctcttgagaattaatcttgcatggttatttacttttgttgttattattctctacatttttaatcatgtacttttccatgttccacttttgttgccaaagctactatatttttcctaccaattcatccaaaactactatattatagcaaggcagctagtggatcgactttgcacttttggatgcaattgtgagtggtttacattagaggggccatgcatagccaaataaattgtttggcaaaatatgatttcccttgtagttagcacaatattgtgatctttcattcctttactctttttgttccaccaccctcattattgcaaagccccctcttttagaaccaaactaaagataagaaacatttgattcatcattagaggagattagatatacatacatactacacatgcattgctgtgataagcctagccaggcacagaaagagccaagacaaaaggagctcaaaagaaaaggggctccaatatcttgcccggcctgatcagtgtaacatgacgtcacccacacaattattaaaaggatagatgcatatgtgttcgttacgtatctccttgtgtcacgttgctgtgcatggttcactcgcttaattataacgtccgtcgcattttatgcatgcacttcgtttttagttaatcaaattaaacaagatcctaacatatgatttctattttattctctttgcaggcaacatcatctccttcatgacctacctggccccactgtaagtcccacacatccggatattttcttttctttagcgaaattttacattgctccagaaagtaccttttacactaaaatttcttatacaccaccataaaattaatgtggtactattggtaccttatcaaaaatgataaaattacctttttcttcagataaaaacactccccgtctctgtataactaagatgtagacaaccaatacacatgtctagagctaatcctatcaattaacattgctagtaaatacaaggaaaaatataaagaattaaccaattgcttggatgtcttgcaggccgacgttctacaggatctacaagagcaagtcgacgcaggggttccagtcggtaccctacgtggtggcgctgttcagcgcgatgctgtggatctactacgcgctgctcaagtccgacgagtgcctcctcatcaccatcaactccgctggctgcgtcatcgagaccatctacatcgccgtctacctcgtctacgcccccaagaaggccaagatgttcaccgccaagctcctcctcctcgtcaacgtcggcgtcttcggcctcatcctcctcctcaccctcctcctctccgccggcgaccgccgcatcgtggttcttggttgggtctgcgttggcttctccgtcagcgtcttcgtcgccccccttagcatcatcgtaagaaaccctagaattgcctgtaaacaataataactttcggtctctgcaccaactaaggatgcacatatttacgcaccgcttttgctatctctgcagaggctggtggtgcgcaccaagagcgtggagttcatgccgttctcgctctccttctccctcaccatcagcgccgtcgtctggttcctctacggcctcctcatcaaggacaaatatgtcgctgtgagtagctccgattcgacccgttcttcttcctaaattttccgctgctcgatttaatttctatttctaattgtggaagattgtttaattatagtgattatggctagctgataaccgattttaatttctgatggtgatccaaaatggaacagcttcccaacgtgctgggcttctccttcggcgtcatccagatggggctgtacgccatgtacaggaactcgacgcccaaggccgtgctgaccaaggaggtcgaggcggcgacggccaccggcgacgacgaccactccgccgccggcgtcaaggagcacgtcgtcaacatcgccaagctctctgccgccgtcgacgtcgtcaagacccgcgaggtgcaccccgtcgacgtcgagtccccgccggcagaggcgccgcctgaggaggacgacaaggccgccgccgccaccgccgccgccgtcgccggcgccggcgagaagaaggtagctgcatgagtgcgtgcatgcgtacatgggtcgccgtaagaaggaagaaggcgtgacgtgtccagcccgtacgcgcgccacgtggccaagctagcttcagagctagtgaagctgcagacatgctagctggctagctagcagtgagagagtgcgacgactaaaaaaaaagtagtgattaattaagggcttgtaatttaatcgttgttttttttttctctgtttcgttgagatcgatatcgttgtcaccatgcatgtatttcgtttttgattctcagtaattaattagatgggctttctgtaattcaacctgtaagggttccttccatgattaattaattagcgtgttaataattgtcccacc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074487.2 RefSeq:Os11g0508600]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
| Line 55: |
Line 26: |
| | [[Category:Japonica Chromosome 11]] | | [[Category:Japonica Chromosome 11]] |
| | [[Category:Chromosome 11]] | | [[Category:Chromosome 11]] |
| | + | == Structured Information == |
Please input one-sentence summary here.
Annotated Information
Function
Os-11N3 is represented in databases by a 1494-base full-length cDNA (National Center for Biotechnology Information accession number AK101913), has four introns, and a predicted coding frame of 909 bp (Figure 2B). BLAST analysis was performed with the predicted protein product of Os11N3 (Os-11N3), and 18 of the most similar proteins from monocotyledonous species and three sequences of the most similar proteins from representative dicotyledonous species were subjected to phylogenetic analysis(Figure 3). While closely related to Os-8N3, Os-11N3 is a member of a distinct clade of N3 proteins (clade II) that are separated from the Os-8N3 clade (clade I) prior to the divergence of dicots and monocots as some members from Arabidopsis thaliana (At5g23660), pepper (Capsicum annuum; CaUPA16), and soybean (Glycine max; GmABT17358) are more similar to Os-11N3 (Figure 3). Os-11N3 is more closely related to another clade represented by the rice N3 gene Os12g0476200. The separation of Os-11N3 from Os12g0476200 occurred prior to the divergence of rice, sorghum (Sorghum bicolor), and maize (Zea mays;Figure 3). The separation of Os-S11N3 from the other members within rice indicates a possible specialization of this protein in plant development or environmental responses.
Expression
Loss or Suppression ofOs-11N3 Expression Results in Loss of TAL Effector-Specific Susceptibility in Rice.The T-DNA insertion event PFG_3D-03008 was previously reported to have occurred within the first intron of Os-11N3 in rice cultivar Hwayoung (Jeong et al., 2006).The requirement for Os-11N3 in AvrXa7- and PthXo3-mediated virulence was also assessed by RNA-mediated gene silencing (RNAi). Transgenic rice plants were generated that expressed a unique 341-base portion of the 39-UTR of Os-11N3 as a small double-stranded RNA to initiate silencing of the full transcript.
Evolution
Variations in the TAL effector repetitive domains are driven by selection to overcome both dominant and recessive forms of resistance to bacterial blight in rice. The finding that Os-8N3 and Os-11N3 encode closely related proteins also provides evidence that N3 proteins have a specific function in facilitating bacterial blight disease.
Labs working on this gene
a Department of Plant Pathology, Kansas State University, Manhattan, Kansas 66506
b Department of Genetics, Development, and Cell Biology, Iowa State University, Ames, Iowa 50011
References
Ginny Antony;Junhui Zhou;Sheng Huang;Ting Lib;Bo Liu;Frank White;Bing Yang
Rice xa13 Recessive Resistance to Bacterial Blight Is Defeated by Induction of the Disease Susceptibility Gene Os-11N3
The Plant Cell, 2010, 22(11): 3864-3876
Structured Information