Difference between revisions of "Os11g0559200"

From RiceWiki
Jump to: navigation, search
(References)
(References)
 
(13 intermediate revisions by 3 users not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
[[File:Xa21-1.jpg|right|thumb|350px|'''Figure 1.''' ''Graphical representation of the chromosome of Xanthomonas oryzae pv. oryzae(from reference<ref name="ref7" />).'']]
 
===Function===
 
===Function===
 
[http://en.wikipedia.org/wiki/Bacterial_blight_(barley) Bacterial blight] is the most destructive bacterial disease of rice distributed all over the world, especiallyin Asia and Africa. '''''OsXa21''''' is the first disease resistance gene cloned from rice, which encodes a receptor-like kinase and confers broad spectrum resistance against Xanthomonas oryzae pv. oryzae ( Xoo ). As a member of pattern recognition receptors (PRRs), '''''OsXa21''''' plays an imortant role in pathogen-associated molecular patterns (PAMPs). It is a resistance gene in plants which is critical to the activation of innate immune response.
 
[http://en.wikipedia.org/wiki/Bacterial_blight_(barley) Bacterial blight] is the most destructive bacterial disease of rice distributed all over the world, especiallyin Asia and Africa. '''''OsXa21''''' is the first disease resistance gene cloned from rice, which encodes a receptor-like kinase and confers broad spectrum resistance against Xanthomonas oryzae pv. oryzae ( Xoo ). As a member of pattern recognition receptors (PRRs), '''''OsXa21''''' plays an imortant role in pathogen-associated molecular patterns (PAMPs). It is a resistance gene in plants which is critical to the activation of innate immune response.
 
* Xa21 encodes a receptor-like kinase, which has 3 parts: a receptor-like kinase (RLK) with leucine-rich repeats (LRR) in the presumed extracellular domain, a transmembrane domain and a serine–threonine protein kinase domain<ref name="ref2" />, the last two part are the most important, because they have correlation with the resistance of Xa21. And this disease resistance gene is a member of a multigene family which has seven family members. Xa21D, an Xa21 gene family member, encodes a predicted protein consisting of a signal peptide and a LRR domain, which is highly similar to the LRR domain of XA21. RLKs play important roles in many biological processes, including development and growth, in both animals and plants<ref name="ref3" />. In the Xa21 gene family, LRRs of different members may have evolved to recognize different pathovars and may confer altered resistance phenotypes.
 
* Xa21 encodes a receptor-like kinase, which has 3 parts: a receptor-like kinase (RLK) with leucine-rich repeats (LRR) in the presumed extracellular domain, a transmembrane domain and a serine–threonine protein kinase domain<ref name="ref2" />, the last two part are the most important, because they have correlation with the resistance of Xa21. And this disease resistance gene is a member of a multigene family which has seven family members. Xa21D, an Xa21 gene family member, encodes a predicted protein consisting of a signal peptide and a LRR domain, which is highly similar to the LRR domain of XA21. RLKs play important roles in many biological processes, including development and growth, in both animals and plants<ref name="ref3" />. In the Xa21 gene family, LRRs of different members may have evolved to recognize different pathovars and may confer altered resistance phenotypes.
 
*In 1992, Ronald located Xa21 on chromosome11<ref name="ref4" />. Based on the frequency with which they discovered polymorphic Xa21-1inked markers, they estimate the size of the introgressed region containing Xa21 to be approximately 800 kb<ref name="ref5" />.
 
*In 1992, Ronald located Xa21 on chromosome11<ref name="ref4" />. Based on the frequency with which they discovered polymorphic Xa21-1inked markers, they estimate the size of the introgressed region containing Xa21 to be approximately 800 kb<ref name="ref5" />.
 +
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672], [http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* The expression analysis made by ''Chang-Jin Park1'' et al. in 2010 showed that ''Xoo'' infection could induce the expression of ''OsXa21'', then regulates XA21-mediated immune response (Figure 2). They further found that the constitutive expression of ''OsXa21'' could enhance resistance to Xoo and the overexpression of ''OsXa21'' up-regulate a new set of defense-related genes<ref name="ref8" />. <br>
 +
[[File:Xa21-2.jpg|right|thumb|350px|'''Figure 2.''' ''The expression pattern of OsXa21 after infected by Xoo(from reference<ref name="ref8" />).'']]
 +
* Thus, they conclude that altering the regulation of ''OsXa21'' could be used for enhancing resistance to ''Xoo'' at multiple developmental stages<ref name="ref8" />.
  
 
===Evolution===
 
===Evolution===
 
*Synteny and phylogenetic analysis showed that frequent gene translocation, duplication and/or loss, have occurred at Xa21 homologous loci, suggesting that they have undergone or are undergoing rapid generation of copy number variations. Many researchers have domenstated that during the evolution of the Xa21 gene family, it’s common to find gene duplication and diversification and they think these processes may associated with the creation of novel resistance phenotypes<ref name="ref3" />.
 
*Synteny and phylogenetic analysis showed that frequent gene translocation, duplication and/or loss, have occurred at Xa21 homologous loci, suggesting that they have undergone or are undergoing rapid generation of copy number variations. Many researchers have domenstated that during the evolution of the Xa21 gene family, it’s common to find gene duplication and diversification and they think these processes may associated with the creation of novel resistance phenotypes<ref name="ref3" />.
*The study by Yang J et al. showed that Xa21 gene in different generation and genetic background could be stably inherited and presented sustained resistance to RBB and no re-sistance decline or loss were found in successive planting for 16 generations(Figure 1)<ref name="ref6" />.
+
*The study by Yang J et al. showed that Xa21 gene in different generation and genetic background could be stably inherited and presented sustained resistance to RBB and no re-sistance decline or loss were found in successive planting for 16 generations<ref name="ref6" />.
 +
===Conserved Domains===
 +
[[File:Xa21-3.png|center|thumb|727px|'''Figure 3.''' ''Structure of OsXa21 (from NCBI BLASTP).'']]
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Line 21: Line 28:
 
* State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, Nanjing 210093, China
 
* State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, Nanjing 210093, China
 
* Genetic Diversity Department, National Institute of Agrobiological Sciences (Tsukuba, Ibaraki 305–8602, Japan)
 
* Genetic Diversity Department, National Institute of Agrobiological Sciences (Tsukuba, Ibaraki 305–8602, Japan)
 +
* Graduate School of Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, South Korea
  
 
==References==
 
==References==
Line 44: Line 52:
 
* <ref name="ref7">
 
* <ref name="ref7">
 
Ochiai H, Inoue Y, Takeya M, et al. Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of large numbers of effector genes and insertion sequences to its race diversity[J]. Japan Agricultural Research Quarterly, 2005, 39(4): 275.
 
Ochiai H, Inoue Y, Takeya M, et al. Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of large numbers of effector genes and insertion sequences to its race diversity[J]. Japan Agricultural Research Quarterly, 2005, 39(4): 275.
 +
</ref>
 +
* <ref name="ref8">
 +
Ronald P C, Albano B, Tabien R, et al. Genetic and physical analysis of the rice bacterial blight disease resistance locus, Xa21[J]. Molecular and General Genetics MGG, 1992, 236(1): 113-120.
 
</ref>
 
</ref>
 
</references>
 
</references>
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os11g0559200|
 
Description = Protein kinase-like domain containing protein|
 
Version = NM_001189679.1 GI:297728488 GeneID:9271075|
 
Length = 3488 bp|
 
Definition = Oryza sativa Japonica Group Os11g0559200, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:22645462..22648949|
 
CDS = 22645516..22648135,22648424..22648800|
 
GCID = <gbrowseImage1>
 
name=NC_008404:22645462..22648949
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:22645462..22648949
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atgatatcactcccattactgctcttcgtcctcttcttctctgcgctgctgctcttcccttcgagcagtgacgacgacggtggtggtgatgctgccggcgacgaactcgcgctgctctctttcaagtcatccctgctataccaggggggccagtcgctggcatcttggaacacgtccggccatggccagcactgcacatgggtgggtgtcgtgtgcggccgccggcacccacacagggtggtgaagctgcggctgcgctcctccaacctggccgggatcatctcgccgtcgctgggcaacctatccttcctcaggacgctgcaactcagcgacaaccacctgtccggcaagataccccaggagctcagccgtctcatcaggctccagcaactggtactgaatttcaacagcctatcgggtgagattccagctgctttgggcaatctaaccagtctctcggttcttgagctgactaacaatacactgtccggagcaatcccttcatctctgggcaaactcacaggtctcactgatcttgcactggctgaaaatacgctgtctggttccatcccatcatctttcggccaattgcgcagattatctttccttagcttagcctttaacaatttaagtggagcgatcccagatcctatttggaacatctcctctctcaccatattcgaagtcatatccaacaagctaagtggtacactgcctacaaatgcattcagtaatcttcctagtctgcaggaggtatacatgtattacaaccagtttcatggtcgtatcccggcatcgataggtaatgcttccaacatctcaatatttaccattggtttaaactcttttagcggtgttgttccaccggagattggaaggatgagaaatcttcagagactagagcttccagaaactcttttggaagctaaagaaacaaatgattggaaattcatgacggcattgacaaattgctccaatcttcaagaagtggaactgggaggttgtaaatttggtggagtcctccctgattctgtttccaatctttcctcttcgcttgtatctctctccattagagataacaaaatttcagggagcttacctagagatatcggtaatctcgttaatttacaatatctttctctcgctaacaactccttgacaggatcccttccctcttccttcagcaagcttaaaaatttacgtcgtctcactgtagataacaacaagttaattggttctctcccattcaccatcggtaatcttacacaactaactaatatggaggtccaatttaatgccttcggtggtacaataccaagcacacttggaaacctgaccaagctgtttcaaataaatcttggccacaataactttatagggcaaattcccattgaaatatttagcattcccgcactctctgaaattttggatgtgtcccatcataacttggagggatcaataccaaaagaaatagggaaacttaaaaatattgtcgaattccatgctgattcgaacaaattatcgggtgagatccctagcaccattggtgaatgccaacttctgcagcatcttttcctgcaaaacaatttcttaaatggtagcatcccaatagctctgactcagttgaaaggtctggacacacttgatctctcaggtaacaatttgtcaggtcagatacctatgtccttaggggacatgcctctgctccactcgctgaacctttcgttcaacagcttccacggtgaagtgccaaccaatggtgtttttgcaaatgcttctgaaatttacatccaaggcaatgcccatatttgcggtggcatacctgaactacatcttccgacgtgttccttaaaatcaagaaagaaaaagaaacatcaaattctgctgttagtggttgttatctgtctcgtttcgacacttgccgtcttttcgttactctacatgcttctaacctgtcataagagaagaaagaaagaagtccctgcaacgacatccatgcaaggccacccaatgatcacttacaagcagctggtaaaagcaacggatggtttttcgtccagccatttgttgggttctggatcttttggctctgtttacaaaggagaatttgatagtcaagatggtgaaatcacaagtcttgttgccgtgaaggtactaaagctggaaactccaaaggcactcaagagtttcacgtccgaatgcgaaacactgcgaaatactcgacaccggaatcttgtcaagatagttacgatttgctcgagcatcgataacagagggaatgatttcaaagcaattgtgtatgacttcatgcccaatggcagtctggaagattggctacaccctgaaacaaatgatcaagcagagcaaaggcacttgactctgcatcagagagtgaccatactacttgatgttgcatgtgcattggaccatcttcacttccatggccctgaacctattgtacactgtgatattaaatcaagcaatgtgttgttagatgctgatatggtagcccatgttggagactttggacttgcaagaatacttattgagggaagctcattgatgcaacagtcaacaagttcgatgggaatcagggggacaattggttacgcagcaccagagtatggtgtcgggaacactgcctcgacacatggagatatttacagttatggaattctagtgttggaaacagtaaccgggatgcggccggcagatagtacattcagaactggattgagcctccgtcagtacgttgaaccgggtctacatggtagactgatggatgttgttgacaggaagcttggtttggattccgagaaatggcttcaggctcgagatgtttcgccatgcagcagtattactgaatgccttgtttcactgcttagacttgggctgtcttgctctcaggaattgccatcgagtagaacgcaagccggagatgtcatcaatgaactgcgtgccatcaaagagtctctctcgatgtcatccgacatgtga</cdnaseq>|
 
AA = <aaseq>MISLPLLLFVLFFSALLLFPSSSDDDGGGDAAGDELALLSFKSS                    LLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLS                    FLRTLQLSDNHLSGKIPQELSRLIRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNN                    TLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPI                    WNISSLTIFEVISNKLSGTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIF                    TIGLNSFSGVVPPEIGRMRNLQRLELPETLLEAKETNDWKFMTALTNCSNLQEVELGG                    CKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPS                    SFSKLKNLRRLTVDNNKLIGSLPFTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQ                    INLGHNNFIGQIPIEIFSIPALSEILDVSHHNLEGSIPKEIGKLKNIVEFHADSNKLS                    GEIPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDM                    PLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICGGIPELHLPTCSLKSRKKKK                    HQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATD                    GFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVKVLKLETPKALKSFTSECETLRNT                    RHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRV                    TILLDVACALDHLHFHGPEPIVHCDIKSSNVLLDADMVAHVGDFGLARILIEGSSLMQ                    QSTSSMGIRGTIGYAAPEYGVGNTASTHGDIYSYGILVLETVTGMRPADSTFRTGLSL                    RQYVEPGLHGRLMDVVDRKLGLDSEKWLQARDVSPCSSITECLVSLLRLGLSCSQELP                    SSRTQAGDVINELRAIKESLSMSSDM</aaseq>|
 
DNA = <dnaseqindica>55..2674#2963..3339#atctctcgctcttgctgtcttagcttgcaccgatattctctgcatctcggcacgatgatatcactcccattactgctcttcgtcctcttcttctctgcgctgctgctcttcccttcgagcagtgacgacgacggtggtggtgatgctgccggcgacgaactcgcgctgctctctttcaagtcatccctgctataccaggggggccagtcgctggcatcttggaacacgtccggccatggccagcactgcacatgggtgggtgtcgtgtgcggccgccggcacccacacagggtggtgaagctgcggctgcgctcctccaacctggccgggatcatctcgccgtcgctgggcaacctatccttcctcaggacgctgcaactcagcgacaaccacctgtccggcaagataccccaggagctcagccgtctcatcaggctccagcaactggtactgaatttcaacagcctatcgggtgagattccagctgctttgggcaatctaaccagtctctcggttcttgagctgactaacaatacactgtccggagcaatcccttcatctctgggcaaactcacaggtctcactgatcttgcactggctgaaaatacgctgtctggttccatcccatcatctttcggccaattgcgcagattatctttccttagcttagcctttaacaatttaagtggagcgatcccagatcctatttggaacatctcctctctcaccatattcgaagtcatatccaacaagctaagtggtacactgcctacaaatgcattcagtaatcttcctagtctgcaggaggtatacatgtattacaaccagtttcatggtcgtatcccggcatcgataggtaatgcttccaacatctcaatatttaccattggtttaaactcttttagcggtgttgttccaccggagattggaaggatgagaaatcttcagagactagagcttccagaaactcttttggaagctaaagaaacaaatgattggaaattcatgacggcattgacaaattgctccaatcttcaagaagtggaactgggaggttgtaaatttggtggagtcctccctgattctgtttccaatctttcctcttcgcttgtatctctctccattagagataacaaaatttcagggagcttacctagagatatcggtaatctcgttaatttacaatatctttctctcgctaacaactccttgacaggatcccttccctcttccttcagcaagcttaaaaatttacgtcgtctcactgtagataacaacaagttaattggttctctcccattcaccatcggtaatcttacacaactaactaatatggaggtccaatttaatgccttcggtggtacaataccaagcacacttggaaacctgaccaagctgtttcaaataaatcttggccacaataactttatagggcaaattcccattgaaatatttagcattcccgcactctctgaaattttggatgtgtcccatcataacttggagggatcaataccaaaagaaatagggaaacttaaaaatattgtcgaattccatgctgattcgaacaaattatcgggtgagatccctagcaccattggtgaatgccaacttctgcagcatcttttcctgcaaaacaatttcttaaatggtagcatcccaatagctctgactcagttgaaaggtctggacacacttgatctctcaggtaacaatttgtcaggtcagatacctatgtccttaggggacatgcctctgctccactcgctgaacctttcgttcaacagcttccacggtgaagtgccaaccaatggtgtttttgcaaatgcttctgaaatttacatccaaggcaatgcccatatttgcggtggcatacctgaactacatcttccgacgtgttccttaaaatcaagaaagaaaaagaaacatcaaattctgctgttagtggttgttatctgtctcgtttcgacacttgccgtcttttcgttactctacatgcttctaacctgtcataagagaagaaagaaagaagtccctgcaacgacatccatgcaaggccacccaatgatcacttacaagcagctggtaaaagcaacggatggtttttcgtccagccatttgttgggttctggatcttttggctctgtttacaaaggagaatttgatagtcaagatggtgaaatcacaagtcttgttgccgtgaaggtactaaagctggaaactccaaaggcactcaagagtttcacgtccgaatgcgaaacactgcgaaatactcgacaccggaatcttgtcaagatagttacgatttgctcgagcatcgataacagagggaatgatttcaaagcaattgtgtatgacttcatgcccaatggcagtctggaagattggctacaccctgaaacaaatgatcaagcagagcaaaggcacttgactctgcatcagagagtgaccatactacttgatgttgcatgtgcattggaccatcttcacttccatggccctgaacctattgtacactgtgatattaaatcaagcaatgtgttgttagatgctgatatggtagcccatgttggagactttggacttgcaagaatacttattgagggaagctcattgatgcaacagtcaacaagttcgatgggaatcagggggacaattggttacgcagcaccaggttaatcctaaactgtttatgtctacctcctttcattgttttttttagatttgctctggtccaacaaaaaatacctaaagatacagatacttgtacctcacaatattaaatagttttcgatcattgcattgttagatctaacgatcaggaaacgatttggtaccgtgcccgtgaggtatcggaatctcaagatattttttgttcgaccgtagcaaatctatttttttgtttgttttcttctctttaatgttttatgactatgaaataatttttatttctggaaaacagagtatggtgtcgggaacactgcctcgacacatggagatatttacagttatggaattctagtgttggaaacagtaaccgggatgcggccggcagatagtacattcagaactggattgagcctccgtcagtacgttgaaccgggtctacatggtagactgatggatgttgttgacaggaagcttggtttggattccgagaaatggcttcaggctcgagatgtttcgccatgcagcagtattactgaatgccttgtttcactgcttagacttgggctgtcttgctctcaggaattgccatcgagtagaacgcaagccggagatgtcatcaatgaactgcgtgccatcaaagagtctctctcgatgtcatccgacatgtgaagatgtgagacatgctgatgttatgtccgagtatttcgttgtaatctaatgtgaagggtgagtgtgtgactgcttggttgtaagctatttcctgatctgcccatcagatcatgtatctgttctattgttgtatttctcagaacaaccac</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189679.1 RefSeq:Os11g0559200], [http://www.ricedata.cn/gene/list/15.htm China Rice Data Center] |
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 85: Line 64:
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 
[[Category:Chromosome 11]]
 +
== Structured Information ==

Latest revision as of 09:08, 13 June 2015

The rice Os11g0559200 was recongized as OsXa21 in 1990s. However, the related research of this gene can date back to the year 1977, when Indian Plant Pathologist Dr. S. Devadath found a strain of Oryza barthii from Manila is resistant to all the races of bacterial blight[1].

Annotated Information

Figure 1. Graphical representation of the chromosome of Xanthomonas oryzae pv. oryzae(from reference[2]).

Function

Bacterial blight is the most destructive bacterial disease of rice distributed all over the world, especiallyin Asia and Africa. OsXa21 is the first disease resistance gene cloned from rice, which encodes a receptor-like kinase and confers broad spectrum resistance against Xanthomonas oryzae pv. oryzae ( Xoo ). As a member of pattern recognition receptors (PRRs), OsXa21 plays an imortant role in pathogen-associated molecular patterns (PAMPs). It is a resistance gene in plants which is critical to the activation of innate immune response.

  • Xa21 encodes a receptor-like kinase, which has 3 parts: a receptor-like kinase (RLK) with leucine-rich repeats (LRR) in the presumed extracellular domain, a transmembrane domain and a serine–threonine protein kinase domain[3], the last two part are the most important, because they have correlation with the resistance of Xa21. And this disease resistance gene is a member of a multigene family which has seven family members. Xa21D, an Xa21 gene family member, encodes a predicted protein consisting of a signal peptide and a LRR domain, which is highly similar to the LRR domain of XA21. RLKs play important roles in many biological processes, including development and growth, in both animals and plants[4]. In the Xa21 gene family, LRRs of different members may have evolved to recognize different pathovars and may confer altered resistance phenotypes.
  • In 1992, Ronald located Xa21 on chromosome11[5]. Based on the frequency with which they discovered polymorphic Xa21-1inked markers, they estimate the size of the introgressed region containing Xa21 to be approximately 800 kb[6].

GO assignment(s): GO:0004672, GO:0004674, GO:0005524, GO:0006468

Expression

  • The expression analysis made by Chang-Jin Park1 et al. in 2010 showed that Xoo infection could induce the expression of OsXa21, then regulates XA21-mediated immune response (Figure 2). They further found that the constitutive expression of OsXa21 could enhance resistance to Xoo and the overexpression of OsXa21 up-regulate a new set of defense-related genes[7].
Figure 2. The expression pattern of OsXa21 after infected by Xoo(from reference[7]).
  • Thus, they conclude that altering the regulation of OsXa21 could be used for enhancing resistance to Xoo at multiple developmental stages[7].

Evolution

  • Synteny and phylogenetic analysis showed that frequent gene translocation, duplication and/or loss, have occurred at Xa21 homologous loci, suggesting that they have undergone or are undergoing rapid generation of copy number variations. Many researchers have domenstated that during the evolution of the Xa21 gene family, it’s common to find gene duplication and diversification and they think these processes may associated with the creation of novel resistance phenotypes[4].
  • The study by Yang J et al. showed that Xa21 gene in different generation and genetic background could be stably inherited and presented sustained resistance to RBB and no re-sistance decline or loss were found in successive planting for 16 generations[8].

Conserved Domains

Figure 3. Structure of OsXa21 (from NCBI BLASTP).

Labs working on this gene

  • Department of Plant Pathology and the Genome Center, University of California Davis, Davis, California 95616, USA.
  • Center for Engineering Plants for Resistance against Pathogens, University of California, Davis, California 9561 6
  • Department of Plant Molecular Systems Biotechnology, Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea.
  • Department of Molecular Microbiology, School of Medicine, Washington University, St. Louis, MO 63110, USA.
  • State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, Nanjing 210093, China
  • Genetic Diversity Department, National Institute of Agrobiological Sciences (Tsukuba, Ibaraki 305–8602, Japan)
  • Graduate School of Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, South Korea

References

  1. KHUSH G S, BACALANGCO E, Ogawa T. 18. A New Gene for Resistance to Bacterial Blight from O. longistaminata. Rice Genet Newslett 1990, 7: 121 ~ 122.
  2. Ochiai H, Inoue Y, Takeya M, et al. Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of large numbers of effector genes and insertion sequences to its race diversity[J]. Japan Agricultural Research Quarterly, 2005, 39(4): 275.
  3. Ronald P C, Albano B, Tabien R, et al. Genetic and physical analysis of the rice bacterial blight disease resistance locus, Xa21[J]. Molecular and General Genetics MGG, 1992, 236(1): 113-120.
  4. 4.0 4.1 Tan S, Wang D, Ding J, et al. Adaptive evolution of Xa21 homologs in Gramineae[J]. Genetica, 2011, 139(11-12): 1465-1475.
  5. Song W Y, Wang G L, Chen L L, et al. A receptor kinase-like protein encoded by the rice disease resistance gene, Xa21[J]. Science, 1995, 270(5243): 1804-1806.
  6. Andaya C B, Ronald P C. A catalytically impaired mutant of the rice Xa21 receptor kinase confers partial resistance to Xanthomonas oryzae pv oryzae[J]. Physiological and molecular plant pathology, 2003, 62(4): 203-208.
  7. 7.0 7.1 7.2 Ronald P C, Albano B, Tabien R, et al. Genetic and physical analysis of the rice bacterial blight disease resistance locus, Xa21[J]. Molecular and General Genetics MGG, 1992, 236(1): 113-120.
  8. Yang J, Ni D, Wu J. Breeding and food safety evaluation of transgenic hybrid rice harboring Xa21 gene[J]. Molecular Plant Breeding, 2006, 14.

Structured Information