Difference between revisions of "Os11g0648000"

From RiceWiki
Jump to: navigation, search
(References)
 
(7 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
''OsNHX3(Os11g0648000)'', is a Na<sup>+</sup>‡and H<sup>+</sup>‡exchanger in rice (''Oryza sativa'')<ref name="ref1"/>.
 
 
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
[[File: OsNHX3 Genomic organization.jpg|right|thumb|300px|'''Figure 1.''''' Genomic organization of the OsNHX3 genes.(from reference <ref name="ref1"/>).'']]
 +
*''OsNHX3'' can suppress the Na<sup>+</sup>, Li<sup>+</sup>, and hygromycin sensitivity of yeast ''nhx1'' mutants and their sensitivity to a high K<sup>+</sup> concentration. The expression of [[Os07g0666900|''OsNHX1'']], [[Os05g0148600|''OsNHX2'']], ''OsNHX3'', and [[Os09g0286400|''OsNHX5'']] is regulated differently in rice tissues and is increased by salt stress, hyperosmotic stress, and ABA<ref name="ref1"/>.
 +
 
 +
*The genomic organization of OsNHX3 is graphically presented in Figure 1. ''OsNHX3'' had 15 exons<ref name="ref1"/>.
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0006814 GO:0006814], [http://amigo.geneontology.org/amigo/term/GO:0006885 GO:0006885], [http://amigo.geneontology.org/amigo/term/GO:0015299 GO:0015299], [http://amigo.geneontology.org/amigo/term/GO:0015385 GO:0015385], [http://amigo.geneontology.org/amigo/term/GO:0016021 GO:0016021]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
[[File: OsNHX Expression01.jpg|right|thumb|210px|'''Figure 2.''''' Expression of OsNHX1, 2, 3, and 5 in rice tissues.(from reference <ref name="ref1"/>).'']]
 +
''Fukuda et al.'' examined the expression of [[Os07g0666900|''OsNHX1'']], [[Os05g0148600|''OsNHX2'']], ''OsNHX3'', and [[Os09g0286400|''OsNHX5'']] in various rice tissues by Northern-blot analysis with total RNA extracted from 8-day-old rice seedlings and 12-weekold rice (7 days after heading). Expression of these genes was regulated differently in different rice tissues (Fig. 2). Compared with other tissues, those of OsNHX3 were higher in flag leaf sheaths and blades <ref name="ref1"/>
 +
 
 +
*Treatment with salt stress, hyperosmotic stress (mannitol), and ABA increased the transcript levels of [[Os07g0666900|''OsNHX1'']], [[Os05g0148600|''OsNHX2'']], ''OsNHX3'', and [[Os09g0286400|''OsNHX5'']] in rice seedlings<ref name="ref1"/>.
 +
 
 +
*Treatment with high concentrations of KCl scarcely changed transcript levels of OsNHX3 (Fig. 5b). In Figure 3, OsNHX3-mediated less K<sup>+</sup> tolerance than the other family genes in yeast mutants. These results suggest that OsNHX3 might have low transport capacity of K<sup>+</sup> and not function in the tolerance of rice seedlings to high concentrations of KCl<ref name="ref1"/>.
 +
 
 +
*The expression of [[Os07g0666900|''OsNHX1'']], [[Os05g0148600|''OsNHX2'']], ''OsNHX3'', and [[Os09g0286400|''OsNHX5'']] might be regulated through different ABA-dependent pathways<ref name="ref1"/>.
  
 
===Evolution===
 
===Evolution===
Please input evolution information here.
+
[[File: OsNHX Phylogenetic01.jpg|left|thumb|220px|'''Figure 3.''''' Phylogenetic analysis of Na<sup>+</sup>/H<sup>+</sup> antiporter proteins.(from reference <ref name="ref1"/>).'']]
 +
[[File: OsNHX Phylogenetic02.jpg|right|thumb|220px|'''Figure 4.''''' Phylogenetic tree of intracellular NHE/NHX exchangers.(from reference <ref name="ref4"/>).'']]
 +
*The OsNHX proteins shared between 29 and 75% identity. OsNHX1 through 4 in particular shared high similarity, with more than 70% identity among OsNHX1 through 3 and more than 50% identity among OsNHX1 through 4. The sequence of LFFIYLLPPI, which is identified as the binding site of amiloride, an inhibitor of eukaryotic Na<sup>+</sup>/H<sup>+</sup> antiporters, was identical among OsNHX1 through 3 and highly conserved in OsNHX4 and 5. The membrane-spanning segments M5 and M6 of OsNHX1, which are well conserved in the eukaryotic Na<sup>+</sup>/H<sup>+</sup> antiporters, also shared high similarity with OsNHX2 through 5, and all of the OsNHX proteins contained the residues important for Na<sup>+</sup>/H<sup>+</sup> antiport activity<ref name="ref2"/><ref name="ref3"/>.
  
You can also add sub-section(s) at will.
+
*OsNHX1 through 4, AtNHX1 through 4, and other most plant NHXtype antiporters are classified into a type I group, and OsNHX5, AtNHX5, AtNHX6, and LeNHX2 from ''L. esculentum'' are classified into the type II group (Fig. 3)<ref name="ref1"/>.
 +
 
 +
*''Arabidopsis'' contains six NHX genes and rice has five, which are distributed in a similar way: AtNHX1–4 and OsNHX1–4 constitute class
 +
I, and AtNHX5–6 and OsNHX5 constitute class II (Fig. 4). Members of the class-I category of Arabidopsis and rice show 54–87% similarity. Similarity among class-II members is 72–79%, but they are only 21–23% similar to class-I isoforms. These data indicate that divergence between class-I and class-II exchangers in plants occurred before the separation of dicotyledons and monocotyledons<ref name="ref2"/>.
 +
 
 +
*''Pires et al.'' observe that multiple independent duplication events have occurred throughout the evolutionary history of the NHX family. Based on the reconciled phylogeny, ''Pires et al.'' estimate 27 independent gene duplication and 40 gene loss events during the diversification of this gene family<ref name="ref5"/>.
 +
 
 +
===Knowledge Extension===
 +
*The Na<sup>+</sup>/H<sup>+</sup>‡exchanger that catalyzes the exchange of Na<sup>+</sup>‡for H<sup>+</sup>‡across membranes, contributes to regulation of internal pH, cell volume, and sodium level in the cytoplasm)<ref name="ref6"/>.
 +
 
 +
*Na<sup>+</sup>/H<sup>+</sup> antiporters, which catalyze the exchange of Na<sup>+</sup> for H<sup>+</sup> across membranes, contribute to the regulation of internal pH, cell volume and the sodium level in the cytoplasm<ref name="ref7"/><ref name="ref8"/>. The antiporters are widespread membrane proteins found in animals, yeasts, bacteria and plants. In particular, vacuolar Na<sup>+</sup>/H<sup>+</sup> antiporters, which compartmentalize Na<sup>+</sup> into the vacuoles for detoxification, have been investigated as the key to salt tolerance in yeasts and plants<ref name="ref9"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Division of Plant Sciences, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
 +
*Graduate School of Life and Environmental Sciences, Tsukuba University, Tennoudai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan
 +
*Instituto de Recursos Naturales y Agrobiologı´a, Consejo Superior de Investigaciones Cientı´ficas, Reina Mercedes 10, Sevilla 41012, Spain
 +
*Department of Biology and Center for Genomics and Systems Biology, New York University, New York, US
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
==Structured Information==
+
Fukuda A, Nakamura A, Hara N, et al. Molecular and functional analyses of rice NHX-type Na+/H+ antiporter genes[J]. Planta, 2011, 233(1): 175-188.
{{JaponicaGene|
+
</ref>
GeneName = Os11g0648000|
+
* <ref name="ref2">
Description = Similar to Na+/H+ antiporter|
+
Bowers K, Levi B P, Patel F I, et al. The sodium/proton exchanger Nhx1p is required for endosomal protein trafficking in the yeast Saccharomyces cerevisiae[J]. Molecular Biology of the Cell, 2000, 11(12): 4277-4294.
Version = NM_001074903.1 GI:115486454 GeneID:4351027|
+
</ref>
Length = 4072 bp|
+
* <ref name="ref3">
Definition = Oryza sativa Japonica Group Os11g0648000, complete gene.|
+
Hamada A, Hibino T, Nakamura T, et al. Na+/H+ Antiporter fromSynechocystis Species PCC 6803, Homologous to SOS1, Contains an Aspartic Residue and Long C-Terminal Tail Important for the Carrier Activity[J]. Plant physiology, 2001, 125(1): 437-446.
Source = Oryza sativa Japonica Group
+
</ref>
 +
* <ref name="ref4">
 +
Pardo J M, Cubero B, Leidi E O, et al. Alkali cation exchangers: roles in cellular homeostasis and stress tolerance[J]. Journal of Experimental Botany, 2006, 57(5): 1181-1199.   
 +
</ref>
 +
* <ref name="ref5">
 +
Pires I S, Negrão S, Pentony M M, et al. Different evolutionary histories of two cation/proton exchanger gene families in plants[J]. BMC plant biology, 2013, 13(1): 97.
 +
</ref>
 +
* <ref name="ref6">
 +
Orlowski J, Grinstein S. Na+/H+ exchangers of mammalian cells[J]. Journal of Biological Chemistry, 1997, 272(36): 22373-22376.
 +
</ref>
 +
* <ref name="ref7">
 +
Aronson P S. Kinetic properties of the plasma membrane Na+-H+ exchanger[J]. Annual Review of Physiology, 1985, 47(1): 545-560.
 +
</ref>
 +
* <ref name="ref8">
 +
Numata M, Orlowski J. Molecular cloning and characterization of a novel (Na+, K+)/H+ exchanger localized to the trans-Golgi network[J]. Journal of Biological Chemistry, 2001, 276(20): 17387-17394.
 +
</ref>
 +
* <ref name="ref9">
 +
Blumwald E, Aharon G S, Apse M P. Sodium transport in plant cells[J]. Biochimica et Biophysica Acta (BBA)-Biomembranes, 2000, 1465(1): 140-151.
 +
</ref>
 +
</references>
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
 
AP = Chromosome 11:27611114..27615185|
 
CDS = 27611400..27611741,27611875..27611958,27612174..27612236,27612323..27612461,27612565..27612672<br>,27612803..27612903,27613014..27613080,27613181..27613227,27613303..27613544<br>,27613637..27613696,27613775..27613872,27614376..27614494,27614613..27614780<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008404:27611114..27615185
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008404:27611114..27615185
 
source=RiceChromosome11
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggagctcgggttggggatggggatggggctgggcgacccgcctgcggactacggctcgatcgcggcggtggggatgttcgtggcgctcatctgcgtctgcatcgtcgtcggccacctcctcgaggagagccgatggatgaacgagtccatcaccgcgctaatcatcgggttgggtactggaggagtgattttgatggtgtcgagctggaagcactcgcgcatactggtgttcagcgaggatctcttcttcatttacctgctcccgccgatcatattcaatgcggggttccaagttaagaagaaacaatttttccgcaacttcatgactattacgttgtttggtgcgattgggaccctaatctctttcagtgtaatttccctcggttctctaggactaatatcaaggctgaacataggttcccttgatcttggagattatcttgcacttggggcaatattctcggcaacagactctgtatgcaccttgcaggttttgaaccaagatgaaacacccttcttgtacagcctggttttcggggaaggtgttgtcaatgatgcaacatcagttgtgctattcaacgcaatgcagaactttgatcttgcaaatttcagcagtgttaaattcttgcaattcattggcaattttctttatctgtttgccacgagcacctttcttggagttgctgctggacttctcagtgcttatatcataaaaaagctgtacttcggcaggcattccactgatcgtgaagtttctattatgatgctcatggcttacttgtcttacatgcttgctgaattgcttgatttgagtggtattcttacggtgttcttctgtggtattgtaatgtcgcactatacctggcataatgtaacagagagttccagggtcacaaccaagcacgccttcgccacattgtcatttatcgccgagacatttctatttctttatgttggtatggatgcattggatatggagaagtggaagattgtcggtgaaacattcagcccaatgaaatctattgctttgagctccactattttgttcttggtgctggtcgcaagagctgcttttgttttcccactatcttttttggcaaatttgaccaaaaaaactgaagagggaaagatctctattaagcagcaagttattatttggtgggcgggtctgatgagaggtgctgtgtccattgcattggcctacaacaagttcacaaggtcaggccacactcaactccctagtaatgctatcatgatcactagtacaatcactgttgttcttttcagcacgatggtctttgggctcctgactaagccattaatcagactcctaattccagcaagacacctcaaccgggaatcgagtgcgctttcggatccacctagcccgaaatccttccttgatccactgatcctgaacggttccgatgtcgatcctgagattggtgtgggcattcgccgaccgacaagcctccgacttctcctagcaagcccgacacagtcggtccaccattactggcgcaagttcgacaacgccttcatgaggccggtgtttgggggccgaggattcgtccccttcgtccccggctcaccaactgaaaggagtgtgccattactccagggaaatgagaactag</cdnaseq>|
 
AA = <aaseq>MELGLGMGMGLGDPPADYGSIAAVGMFVALICVCIVVGHLLEES                    RWMNESITALIIGLGTGGVILMVSSWKHSRILVFSEDLFFIYLLPPIIFNAGFQVKKK                    QFFRNFMTITLFGAIGTLISFSVISLGSLGLISRLNIGSLDLGDYLALGAIFSATDSV                    CTLQVLNQDETPFLYSLVFGEGVVNDATSVVLFNAMQNFDLANFSSVKFLQFIGNFLY                    LFATSTFLGVAAGLLSAYIIKKLYFGRHSTDREVSIMMLMAYLSYMLAELLDLSGILT                    VFFCGIVMSHYTWHNVTESSRVTTKHAFATLSFIAETFLFLYVGMDALDMEKWKIVGE                    TFSPMKSIALSSTILFLVLVARAAFVFPLSFLANLTKKTEEGKISIKQQVIIWWAGLM                    RGAVSIALAYNKFTRSGHTQLPSNAIMITSTITVVLFSTMVFGLLTKPLIRLLIPARH                    LNRESSALSDPPSPKSFLDPLILNGSDVDPEIGVGIRRPTSLRLLLASPTQSVHHYWR                    KFDNAFMRPVFGGRGFVPFVPGSPTERSVPLLQGNEN</aaseq>|
 
DNA = <dnaseqindica>3445..3786#3228..3311#2950..3012#2725..2863#2514..2621#2283..2383#2106..2172#1959..2005#1642..1883#1490..1549#1314..1411#692..810#406..573#atactatctcgaaacgataaaaaagagcacaaattcttctcctgttagtaattctgttcgaattcctctccttccccaaaaaagagtggagttcatctccgccacgcggggttaccgataaaaatcccccaaatttccgctcccaccccgtcggattctcccccgaatccgagagttcatcgttttccgccgatttattttatctggttttgtaaaccagcagcccaattgctctctgccttcgtctacctcgtggaagattccgggtcaaattctagactttttggtgggttgcgtgcgaggggtggaggttgcttcgaaggcaagcgttggggggggggggggggattggattttgaggagggagggagggagtagggtttggtaattggaggaggtggagtaatggagctcgggttggggatggggatggggctgggcgacccgcctgcggactacggctcgatcgcggcggtggggatgttcgtggcgctcatctgcgtctgcatcgtcgtcggccacctcctcgaggagagccgatggatgaacgagtccatcaccgcgctaatcatcgtgagtcgatgagttcttgttgagttgtgctgtttattatgtgagattttgggagatgatggtggttttcgtttggtgtttgattgtttgtggtgtgtgtgtctggggtttcttgcaggggttgggtactggaggagtgattttgatggtgtcgagctggaagcactcgcgcatactggtgttcagcgaggatctcttcttcatttacctgctcccgccgatcatattcaatgcggggtaagctgtttcatgtgaattaagattgtgctatcatggtgatgattttctttataattagagtcgtctttgcaaaagtagtgagtgataaggaagaaaatatgcaggggcaattagttgtgagttccatgctggaacgtgatataattgggttgttactaaatggagctgctattgcttctctctttgaaattatcatgctaattaaggcaatatcacttatgagatgtatgcgtttttgtagtacacgtaaattgtgcctcttcagttctgtagtaggagtatttggaatgggaaattttacttttccacttctttgtatcaaactgattttgctaattaaggtacacctagctatcaaatgcatacacatagtgcacattattatagcaattaaactctctaatcttccagtaggaaattctgttacatcatttaaagtttaacattagtcagcaaggtgaagcttactgttcctttttttctctttctttcctgagcaggttccaagttaagaagaaacaatttttccgcaacttcatgactattacgttgtttggtgcgattgggaccctaatctctttcagtgtaatttccctcggtaagttgttttcctctttaaattttacctggcatgttcttttgtgctcatctctctcactcgtacattccatcacaggttctctaggactaatatcaaggctgaacataggttcccttgatcttggagattatcttggtcagttcttatatgaacctaatgcgtaagcatttcgattgcatgcctgtggttctgtgttttgacttgttccgcatgtgaacttttttcagcacttggggcaatattctcggcaacagactctgtatgcaccttgcaggttttgaaccaagatgaaacacccttcttgtacagcctggttttcggggaaggtgttgtcaatgatgcaacatcagttgtgctattcaacgcaatgcagaactttgatcttgcaaatttcagcagtgttaaattcttgcaattcattggcaattttctttatctgtttgccacgagcacctttcttggagttgctgtaagttctttcctgctcactccaatctttatctttgtcaatgtttctttttcctaaagcatgatatgactgcaggctggacttctcagtgcttatatcataaaaaagctgtacttcggcaggtttgtacaacacaccacattatgtggttgatatttgtatgatcaatcaccagacattttataataattctctaatccatgaattataccttcaatccaggcattccactgatcgtgaagtttctattatgatgctcatggcttacttgtcttacatgcttgctgaagtaagcaccctgtactattagcatcatatagatcctgcagatttgagcaatgtcagctaaatttaattgtaatggataatctgatattaacctgtttctttttgtggcagttgcttgatttgagtggtattcttacggtgttcttctgtggtattgtaatgtcgcactatacctggcataatgtaacagagagttccagggtcacaaccaagtaagtatctttatggtttgtttcagcaaacttattattccattttcatttttttaacttgatgatttcaaatatgtatttcctgaaattgtgtatcacactgatgcttctctaattgtatactctataggcacgccttcgccacattgtcatttatcgccgagacatttctatttctttatgttggtatggatgcattggatatggagaagtggaagattgtcggtgaaacattcaggtatgctctctgtgggtgtgggaagtaaccatatatgttgttcagttgcccaattaatagataataattgtaatatgtgtaacatatttcttatcctgtgcagcccaatgaaatctattgctttgagctccactattttgttcttggtgctggtcgcaagagctgcttttgttttcccactatcttttttggcaaatttgaccaaaaaaactgaagagggaaagatctctattaagcagcaagtgagtgttttatttagcagcatcttaggcttgctatcttctcttataaggggactttcaggttacttatgatgtgggttattcaggttattatttggtgggcgggtctgatgagaggtgctgtgtccattgcattggcctacaacaaggtaacatttgatctgttcgacctgtgctttagcttgtacaagtttgtgtgatcttgaaatttcatatttgactggctgcttgataaagacacgtgcagcttgcctgtttataaactaacttgtttgaggctggattttttttgtttgctttcgtgtattaactattgttcgtaattcatgctttgatctgaaacttgtcacttcgacacttgcagttcacaaggtcaggccacactcaactccctagtaatgctatcatgatcactagtacaatcactgttgttcttttcagcacgatggtaagttctctctcaaacaaacacaaccctgtgcaatacatccttcggttcaaagggagacagtatgaaagctgatccctgaacaattccacaagttggttctgataaaatcatctctcttatgttccctcaggtctttgggctcctgactaagccattaatcagactcctaattccagcaagacacctcaaccgggaatcgagtgcgctttcggatccacctagcccgaaatccttccttgatccactgatcctgaacggttccgatgtcgatcctgagattggtgtgggcattcgccgaccgacaagcctccgacttctcctagcaagcccgacacagtcggtccaccattactggcgcaagttcgacaacgccttcatgaggccggtgtttgggggccgaggattcgtccccttcgtccccggctcaccaactgaaaggagtgtgccattactccagggaaatgagaactagaaaactttttcaaaggagcgtgccattactccagggaaatgagagctagaaaacataaacaaaggttgtgtaaatctgaggtagaagaacaatcagcaaacacagtttctgtaaatttatctgaggtagtaacagcgttcttggtagctgtggtacatgctgatgtgttatgtacctaatattgtagatagcatggatgtatatatataaagcctctgtagtttagcaagaaatggtgctgaaaattttgccacgatttatacaatatggtatgatttttgcattc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074903.1 RefSeq:Os11g0648000]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 57: Line 79:
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Japonica Chromosome 11]]
 
[[Category:Chromosome 11]]
 
[[Category:Chromosome 11]]
 +
== Structured Information ==

Latest revision as of 09:09, 13 June 2015

OsNHX3(Os11g0648000), is a Na+‡and H+‡exchanger in rice (Oryza sativa)[1].

Annotated Information

Function

Figure 1. Genomic organization of the OsNHX3 genes.(from reference [1]).
  • OsNHX3 can suppress the Na+, Li+, and hygromycin sensitivity of yeast nhx1 mutants and their sensitivity to a high K+ concentration. The expression of OsNHX1, OsNHX2, OsNHX3, and OsNHX5 is regulated differently in rice tissues and is increased by salt stress, hyperosmotic stress, and ABA[1].
  • The genomic organization of OsNHX3 is graphically presented in Figure 1. OsNHX3 had 15 exons[1].

GO assignment(s): GO:0006814, GO:0006885, GO:0015299, GO:0015385, GO:0016021

Expression

Figure 2. Expression of OsNHX1, 2, 3, and 5 in rice tissues.(from reference [1]).

Fukuda et al. examined the expression of OsNHX1, OsNHX2, OsNHX3, and OsNHX5 in various rice tissues by Northern-blot analysis with total RNA extracted from 8-day-old rice seedlings and 12-weekold rice (7 days after heading). Expression of these genes was regulated differently in different rice tissues (Fig. 2). Compared with other tissues, those of OsNHX3 were higher in flag leaf sheaths and blades [1]

  • Treatment with salt stress, hyperosmotic stress (mannitol), and ABA increased the transcript levels of OsNHX1, OsNHX2, OsNHX3, and OsNHX5 in rice seedlings[1].
  • Treatment with high concentrations of KCl scarcely changed transcript levels of OsNHX3 (Fig. 5b). In Figure 3, OsNHX3-mediated less K+ tolerance than the other family genes in yeast mutants. These results suggest that OsNHX3 might have low transport capacity of K+ and not function in the tolerance of rice seedlings to high concentrations of KCl[1].
  • The expression of OsNHX1, OsNHX2, OsNHX3, and OsNHX5 might be regulated through different ABA-dependent pathways[1].

Evolution

Figure 3. Phylogenetic analysis of Na+/H+ antiporter proteins.(from reference [1]).
Figure 4. Phylogenetic tree of intracellular NHE/NHX exchangers.(from reference [2]).
  • The OsNHX proteins shared between 29 and 75% identity. OsNHX1 through 4 in particular shared high similarity, with more than 70% identity among OsNHX1 through 3 and more than 50% identity among OsNHX1 through 4. The sequence of LFFIYLLPPI, which is identified as the binding site of amiloride, an inhibitor of eukaryotic Na+/H+ antiporters, was identical among OsNHX1 through 3 and highly conserved in OsNHX4 and 5. The membrane-spanning segments M5 and M6 of OsNHX1, which are well conserved in the eukaryotic Na+/H+ antiporters, also shared high similarity with OsNHX2 through 5, and all of the OsNHX proteins contained the residues important for Na+/H+ antiport activity[3][4].
  • OsNHX1 through 4, AtNHX1 through 4, and other most plant NHXtype antiporters are classified into a type I group, and OsNHX5, AtNHX5, AtNHX6, and LeNHX2 from L. esculentum are classified into the type II group (Fig. 3)[1].
  • Arabidopsis contains six NHX genes and rice has five, which are distributed in a similar way: AtNHX1–4 and OsNHX1–4 constitute class

I, and AtNHX5–6 and OsNHX5 constitute class II (Fig. 4). Members of the class-I category of Arabidopsis and rice show 54–87% similarity. Similarity among class-II members is 72–79%, but they are only 21–23% similar to class-I isoforms. These data indicate that divergence between class-I and class-II exchangers in plants occurred before the separation of dicotyledons and monocotyledons[3].

  • Pires et al. observe that multiple independent duplication events have occurred throughout the evolutionary history of the NHX family. Based on the reconciled phylogeny, Pires et al. estimate 27 independent gene duplication and 40 gene loss events during the diversification of this gene family[5].

Knowledge Extension

  • The Na+/H+‡exchanger that catalyzes the exchange of Na+‡for H+‡across membranes, contributes to regulation of internal pH, cell volume, and sodium level in the cytoplasm)[6].
  • Na+/H+ antiporters, which catalyze the exchange of Na+ for H+ across membranes, contribute to the regulation of internal pH, cell volume and the sodium level in the cytoplasm[7][8]. The antiporters are widespread membrane proteins found in animals, yeasts, bacteria and plants. In particular, vacuolar Na+/H+ antiporters, which compartmentalize Na+ into the vacuoles for detoxification, have been investigated as the key to salt tolerance in yeasts and plants[9].

Labs working on this gene

  • Division of Plant Sciences, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
  • Graduate School of Life and Environmental Sciences, Tsukuba University, Tennoudai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan
  • Instituto de Recursos Naturales y Agrobiologı´a, Consejo Superior de Investigaciones Cientı´ficas, Reina Mercedes 10, Sevilla 41012, Spain
  • Department of Biology and Center for Genomics and Systems Biology, New York University, New York, US

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Fukuda A, Nakamura A, Hara N, et al. Molecular and functional analyses of rice NHX-type Na+/H+ antiporter genes[J]. Planta, 2011, 233(1): 175-188.
  2. Pardo J M, Cubero B, Leidi E O, et al. Alkali cation exchangers: roles in cellular homeostasis and stress tolerance[J]. Journal of Experimental Botany, 2006, 57(5): 1181-1199.
  3. 3.0 3.1 Bowers K, Levi B P, Patel F I, et al. The sodium/proton exchanger Nhx1p is required for endosomal protein trafficking in the yeast Saccharomyces cerevisiae[J]. Molecular Biology of the Cell, 2000, 11(12): 4277-4294.
  4. Hamada A, Hibino T, Nakamura T, et al. Na+/H+ Antiporter fromSynechocystis Species PCC 6803, Homologous to SOS1, Contains an Aspartic Residue and Long C-Terminal Tail Important for the Carrier Activity[J]. Plant physiology, 2001, 125(1): 437-446.
  5. Pires I S, Negrão S, Pentony M M, et al. Different evolutionary histories of two cation/proton exchanger gene families in plants[J]. BMC plant biology, 2013, 13(1): 97.
  6. Orlowski J, Grinstein S. Na+/H+ exchangers of mammalian cells[J]. Journal of Biological Chemistry, 1997, 272(36): 22373-22376.
  7. Aronson P S. Kinetic properties of the plasma membrane Na+-H+ exchanger[J]. Annual Review of Physiology, 1985, 47(1): 545-560.
  8. Numata M, Orlowski J. Molecular cloning and characterization of a novel (Na+, K+)/H+ exchanger localized to the trans-Golgi network[J]. Journal of Biological Chemistry, 2001, 276(20): 17387-17394.
  9. Blumwald E, Aharon G S, Apse M P. Sodium transport in plant cells[J]. Biochimica et Biophysica Acta (BBA)-Biomembranes, 2000, 1465(1): 140-151.

Structured Information