|
|
| (2 intermediate revisions by 2 users not shown) |
| Line 23: |
Line 23: |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| | Please input related labs here. | | Please input related labs here. |
| | + | |
| | National Key Laboratory for Rice Biology, Institute of | | National Key Laboratory for Rice Biology, Institute of |
| | Biotechnology, Zhejiang University, Hangzhou 310058, | | Biotechnology, Zhejiang University, Hangzhou 310058, |
| Line 39: |
Line 40: |
| | grisea are distinct. Phytopathology 95:1248–1255 | | grisea are distinct. Phytopathology 95:1248–1255 |
| | | | |
| − | ==Structured Information==
| |
| − | {{JaponicaGene|
| |
| − | GeneName = Os12g0123700|
| |
| − | Description = No apical meristem (NAM) protein domain containing protein|
| |
| − | Version = NM_001072566.2 GI:297612570 GeneID:4351369|
| |
| − | Length = 2151 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os12g0123700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − |
| |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
| |
| − | AP = Chromosome 12:1138157..1140307|
| |
| − | CDS = 1138361..1138532,1138660..1138982|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008405:1138157..1140307
| |
| − | source=RiceChromosome12
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008405:1138157..1140307
| |
| − | source=RiceChromosome12
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccatcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggcgctgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgcacgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcttgtcaactccgacgagcgacaacatcggcgtcaagaaggccctagtcttctacaagggcaagccccccaagggcgtcaagaccgactggatcatgcacgagtatcgcctcacaggcacatcagctaacaacaccaccaccacaaagcagcgtagagcatcatccatgaccatgagggtgagattcatttaa</cdnaseq>|
| |
| − | AA = <aaseq>MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASIKCPVPIIA EVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL STPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANNTTTTKQRRASSMTMR VRFI</aaseq>|
| |
| − | DNA = <dnaseqindica>205..376#504..826#atttcaatccttcctcttccttagcttattagcttccttccttcactagtgccagttttcctcctacgtaatctaagctagccaggtcgtcatcttcttccttcagctcacgctgaccaaacaccatctgttattctgtttgtttgtttttttttaaaaaaagaaaaaaaatctagctaggcgagccgattgaaggagctgagcatgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccatcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaactaactaactaatcaccatacatatataaactatccatgtatcaattaaactcgatcaaattaatgccttcaaactgaccaaatttaattttgggctttgaaaatggatatggaatgttgcaggtaaggcgctgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgcacgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcttgtcaactccgacgagcgacaacatcggcgtcaagaaggccctagtcttctacaagggcaagccccccaagggcgtcaagaccgactggatcatgcacgagtatcgcctcacaggcacatcagctaacaacaccaccaccacaaagcagcgtagagcatcatccatgaccatgagggtgagattcatttaattacttaattttagttcattattaatttgtttttctcttcgtcgtacgtcttctttgaaagctacgtcgttgtttgaattggcatattgaaggaagcaaacgtgcatgttgctcttagttaactcactctacaaagtcaaatttgttgatgttgattgagcttgtgttttattctttattttaaaaataaataaagcaagtttgcacacttctaattattgtttactgcatttgtgatattgttcatcagctggacgactgggtgctgtgcagaatccacaagaagagcaacgacttcaattcctctgaccaacacgaccaagaacccgagggatcaaccgtcgatgaacagcttgaagacatccatgacaacaactcttcctctcaacaacctcctgctccacctgacatgaacaaccaacagtcagatttccagcccatgacggcgatgagcatgagcaagtcatgctccctcaccgatctcctcaacaacctcgactgcgccgcgctctcgcagtttctcctcgacggctcatccgacgccatcgctgagcttcctgctcctcccagccctctaatatatccaaaccaaacactaaactataacatcaacaacaacatgccacacgccttcgagtcacgcctagatcatcacgatggttacgttaacaattataatgttaatggcctaaggaggaagagaatgatggcgtgtagtgcaacttcttttgatgatggcagcagcagcagcagcagtgactttttgcatgttgccaagaaaccgctgctgctgccaagtgattcaaggggcagtggttttggaggaggttactgcaaccagcagctttcagagactgcgactggttttcagtttcagaacggcaatatgttgagccatccatttcctctgaaccagcagctactgctgaacaatcatctgcagatgcagtagctagtaggcgtctagatccgtttaccgatcgatctgaagagaggtgaattaatttcaacgaatgaaactacagattcagagaggaagatactgattgttccatttggatttattttgaggagttgcatgacagatagacaaacagacggaattcttgatgtaacccatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttgttttcattttcatgtacaagaatgtaaattataaatggtaatatcgtgcaagctagtactcaagccaatttatatgataatctttatgcatgtttcttaattattctggtatcaagcacacgaaagaaacatgctactttgtcgttgattc</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072566.2 RefSeq:Os12g0123700]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
| Line 77: |
Line 46: |
| | [[Category:Japonica Chromosome 12]] | | [[Category:Japonica Chromosome 12]] |
| | [[Category:Chromosome 12]] | | [[Category:Chromosome 12]] |
| | + | ==Structured Information== |
Latest revision as of 09:16, 13 June 2015
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Os12g0123700 includes NAC Family Genes in Oryza sativa, NAC Family Genes has some functions such as Morphogenesis, the response to stress stimuli.
Analysis of NAC Family Genes.[[File:https://www.google.com.hk/url?sa=i&rct=j&q=&esrc=s&source=images&cd=&cad=rja&uact=8&docid=8w_3eG7oUYI6HM&tbnid=5CtRXASPkggi8M:&ved=0CAUQjRw&url=%68%74%74%70%3a%2f%2f%61%62%63%2e%63%62%69%2e%70%6b%75%2e%65%64%75%2e%63%6e%2f%73%65%6d%69%6e%61%72%2f%63%61%61%73%31%32%66%32%2d%30%37%2e%70%64%66&ei=4-WGU6mLLYbj8AWGhIG4Dg&psig=AFQjCNEzzXS5x8fHD_NoUgjl21YTng1Jew&ust=1401435980393481]] NAM are involved in shoot apical meristem formation and development.
Functions of rice NAC transcriptional factors, ONAC122 and ONAC131, in defense responses against Magnaporthe grisea.
NAC (NAM/ATAF/CUC) transcription factors have important functions in regulating plant growth, development, and abiotic and biotic stress responses.ONAC131 have important roles in rice disease resistance responses through the regulated expression of other defense- and signaling-related genes.
Expression
Please input expression information here.
The proteins of this gene localize to the nucleus when express ectopically and have transcriptional activation activities
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
National Key Laboratory for Rice Biology, Institute of
Biotechnology, Zhejiang University, Hangzhou 310058,
Zhejiang, China
References
Please input cited references here.
1. Lijun Sun;Huijuan Zhang;Dayong Li;Lei Huang;Yongbo Hong;Xin Shun Ding;Richard S. Nelson;Xueping Zhou;Fengming Song
Functions of rice NAC transcriptional factors, ONAC122 and ONAC131, in defense responses against Magnaporthe grisea
Plant Molecular Biology, 2013, 81(1-2): 41-56
2.Ooka H, Satoh K, Doi K, Nagata T, Otomo Y, Murakami K,Matsubara K, Osato N, Kawai J, Carninci P, Hayashizaki Y,
Suzuki K, Kojima K, Takahara Y, Yamamoto K, Kikuchi S (2003) Comprehensive analysis of NAC family genes in Oryza
sativa and Arabidopsis thaliana. DNA Res 10:239–247
3.Ahn IP, Kim S, Kang S, Suh SC, Lee YH (2005) Rice defense mechanisms against Cochliobolus miyabeanus and Magnaporthe
grisea are distinct. Phytopathology 95:1248–1255
Structured Information