|
|
| (One intermediate revision by one other user not shown) |
| Line 1: |
Line 1: |
| − | {{JaponicaGene|
| + | Please input one-sentence summary here. |
| − | GeneName = Os12g0568500|
| |
| − | Description = Plant metallothionein, family 15 protein,play a role in the early detoxification of Cd|
| |
| − | Version = NM_001073598.2 GI:297613380 GeneID:4352564|
| |
| − | Length = 969 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os12g0568500, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| + | ==Annotated Information== |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| + | ===Function=== |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| + | Please input function information here. |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| + | |
| − | |
| + | ===Expression=== |
| − | Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
| + | Please input expression information here. |
| − | AP = Chromosome 12:23594146..23595114|
| + | |
| − | CDS = 23594496..23594505,23594616..23594699,23594990..23595045|
| + | ===Evolution=== |
| − | GCID = <gbrowseImage1>
| + | Please input evolution information here. |
| − | name=NC_008405:23594146..23595114
| + | |
| − | source=RiceChromosome12
| + | You can also add sub-section(s) at will. |
| − | preset=GeneLocation
| + | |
| − | </gbrowseImage1>|
| + | ==Labs working on this gene== |
| − | GSID = <gbrowseImage2>
| + | Please input related labs here. |
| − | name=NC_008405:23594146..23595114
| + | |
| − | source=RiceChromosome12
| + | ==References== |
| − | preset=GeneLocation
| + | Please input cited references here. |
| − | </gbrowseImage2>|
| + | |
| − | CDNA = <cdnaseq>atgtcgtgcggtggaagttgcaactgcggttcttgcggctgcggcggtggctgtggaaagatgtaccctgacctggctgagaagatcaacaccaccatcactactgcaaccactgtcctcggtgttgcacctgagaagggggcattttga</cdnaseq>|
| + | ==Structured Information== |
| − | AA = <aaseq>MSCGGSCNCGSCGCGGGCGKMYPDLAEKINTTITTATTVLGVAP EKGAF</aaseq>|
| |
| − | DNA = <dnaseqindica>610..619#416..499#70..125#atatcaagctttcaatctctcattgcatacaagttcctgaagagtttacaagagacccagaagatcaagatgtcgtgcggtggaagttgcaactgcggttcttgcggctgcggcggtggctgtgggtatgtatgctcttcaggcttcagttactgattctgaatctgaaaatatgttgcctatatacatggtcattcaagctaaactgacacaaactttcagagatagcacccatttattttgagtgattttggtatgtttcgcatgttgaaaatcatactattgctgctcctatgtttctgcttccccatttatctgaagttatattcagatgaagccatccataagaggacaagagatttttcatttctggttactgaatttcattgtttctactatgtttttcttggttcagaaagatgtaccctgacctggctgagaagatcaacaccaccatcactactgcaaccactgtcctcggtgttgcacctgagaaggggtatgaatgatatcgaagaatctttgcccagaaaagctaaccagaagaaaatcctgattgagcttcatgcctgaaactcttatttgctgaatttggcttgtttctttgcaggcattttgaggtgatggttggcaaggcaggtgagtctggtgaggctgcccatggctgcagctgtggctccagctgcaagtgcaacccctgcaactgctaaggccaagatgatctatgactgaattgccaatgcaccagcctgtctacatgatgaataaataaagagtccatccagtgtgatggctcatgcctgtgtgtgtgtgtgtttgtctcaaccatgtgcgaatcaggtgtcaaaagtccgtggctggaaatcaatgtggtttctggctttatgtaaatgttgtttgtgaaatataaatattggtttgtctatgaattttactcttactctgtgaaatataaatattggtttgtct</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001073598.2 RefSeq:Os12g0568500]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
