Difference between revisions of "Os12g0603700"

From RiceWiki
Jump to: navigation, search
(References)
 
(One intermediate revision by one other user not shown)
Line 46: Line 46:
 
</references>
 
</references>
  
==Structured Information==
 
{{JaponicaGene|
 
GeneName = Os12g0603700|
 
Description = Protein kinase-like domain containing protein|
 
Version = NM_001073746.1 GI:115489453 GeneID:4352728|
 
Length = 1360 bp|
 
Definition = Oryza sativa Japonica Group Os12g0603700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
 
AP = Chromosome 12:25671309..25672668|
 
CDS = 25671309..25672079,25672096..25672668|
 
GCID = <gbrowseImage1>
 
name=NC_008405:25671309..25672668
 
source=RiceChromosome12
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008405:25671309..25672668
 
source=RiceChromosome12
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggctgccatggacgcgaggaagaagaagagcggcggcggcggcggcgagccgcttctcggcaagtatgagcttgggcggatgcttgggcgagggacgttcgccaaggtgtacctggcgcgcgcggtggccggcggcgaggcggtggcggtgaaggtgatcgacaaggcggaggtgatgggcacggcgggcatggcgccgcgcgtgctccgggaggtggcggcgatgcggcggctgcgccacccgcacgtgctgcgcctccacgaggtgctcgccacgcgcgccaggatctacctcgtcatggagctcgccaccggcggcgacctcctgtcgaggctggcggcgctgccgcggcggcgcctgcccgagagcgcggcgcgccgggtgttcgtccagctcgtcgacgcgctgtcctactgccacgcgcgcggcgtggcgcaccgtgacgtgaagccgcagaacgtcctcctcgacggcgacggcaacctcaaggtctccgacttcggcctcgccgcgctcccgggacacgctccgcgacgacggccgcctccacaccgcgtgcggcacgccggcgtgctccgccgcagggcctacgacggcgccaaggccgacgcgtggtcgtgcggcgtcatcctcttcgtcctcctcgccggccacctccccttcgacgactccaacatcgccgacatgtgccggaaggcgcaccgccgcgagtacgagctcccgcggtgggtgtcccagccggcgcgccgcctggtgagccgcctgctcgacccgaacccggacacccgcgtcgccgtcgagtcgctggcggcgcaccacccgtggttcaagcgctcgctcagcgtcgactcccagctcgacggcctcctcaacggcgagccagagcgcgccgtggcgttccaggcggcgccgccgccgccgctgaacgcgttcgacatcatctccatgtctcccgggctcgacctgtccgggctgttcggcgaacacgacaagagcctaagggagaagcggttcacgacgacggcgtcgccggagaagacgctggagcagctcggcctcgccggcgggaagctcgggtacgtggtggtggtggggaagaaaggggtggagtgcttgccgctggcgggggggcggctgtcgtcggggatcgccgcgatgtcggtggagatgtcggaggtggcgccgccgctgttgctcgtcgagctgaggctggaggtcgccgccggcgacgtcgacggcggcgacggcgaggtgaaggggtttgggtgggagcagctgagaatggagctaggtgatgtagttagggcttggcatagttgtgaggatttgtgtgaaatttag</cdnaseq>|
 
AA = <aaseq>MAAMDARKKKSGGGGGEPLLGKYELGRMLGRGTFAKVYLARAVA                    GGEAVAVKVIDKAEVMGTAGMAPRVLREVAAMRRLRHPHVLRLHEVLATRARIYLVME                    LATGGDLLSRLAALPRRRLPESAARRVFVQLVDALSYCHARGVAHRDVKPQNVLLDGD                    GNLKVSDFGLAALPGHAPRRRPPPHRVRHAGVLRRRAYDGAKADAWSCGVILFVLLAG                    HLPFDDSNIADMCRKAHRREYELPRWVSQPARRLVSRLLDPNPDTRVAVESLAAHHPW                    FKRSLSVDSQLDGLLNGEPERAVAFQAAPPPPLNAFDIISMSPGLDLSGLFGEHDKSL                    REKRFTTTASPEKTLEQLGLAGGKLGYVVVVGKKGVECLPLAGGRLSSGIAAMSVEMS                    EVAPPLLLVELRLEVAAGDVDGGDGEVKGFGWEQLRMELGDVVRAWHSCEDLCEI</aaseq>|
 
DNA = <dnaseqindica>590..1360#1..573#atggctgccatggacgcgaggaagaagaagagcggcggcggcggcggcgagccgcttctcggcaagtatgagcttgggcggatgcttgggcgagggacgttcgccaaggtgtacctggcgcgcgcggtggccggcggcgaggcggtggcggtgaaggtgatcgacaaggcggaggtgatgggcacggcgggcatggcgccgcgcgtgctccgggaggtggcggcgatgcggcggctgcgccacccgcacgtgctgcgcctccacgaggtgctcgccacgcgcgccaggatctacctcgtcatggagctcgccaccggcggcgacctcctgtcgaggctggcggcgctgccgcggcggcgcctgcccgagagcgcggcgcgccgggtgttcgtccagctcgtcgacgcgctgtcctactgccacgcgcgcggcgtggcgcaccgtgacgtgaagccgcagaacgtcctcctcgacggcgacggcaacctcaaggtctccgacttcggcctcgccgcgctcccgggacacgctccgcgacgacggccgcctccacaccgcgtgcggcacgccggcgtacgcggcgcccgaggtgctccgccgcagggcctacgacggcgccaaggccgacgcgtggtcgtgcggcgtcatcctcttcgtcctcctcgccggccacctccccttcgacgactccaacatcgccgacatgtgccggaaggcgcaccgccgcgagtacgagctcccgcggtgggtgtcccagccggcgcgccgcctggtgagccgcctgctcgacccgaacccggacacccgcgtcgccgtcgagtcgctggcggcgcaccacccgtggttcaagcgctcgctcagcgtcgactcccagctcgacggcctcctcaacggcgagccagagcgcgccgtggcgttccaggcggcgccgccgccgccgctgaacgcgttcgacatcatctccatgtctcccgggctcgacctgtccgggctgttcggcgaacacgacaagagcctaagggagaagcggttcacgacgacggcgtcgccggagaagacgctggagcagctcggcctcgccggcgggaagctcgggtacgtggtggtggtggggaagaaaggggtggagtgcttgccgctggcgggggggcggctgtcgtcggggatcgccgcgatgtcggtggagatgtcggaggtggcgccgccgctgttgctcgtcgagctgaggctggaggtcgccgccggcgacgtcgacggcggcgacggcgaggtgaaggggtttgggtgggagcagctgagaatggagctaggtgatgtagttagggcttggcatagttgtgaggatttgtgtgaaatttag</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001073746.1 RefSeq:Os12g0603700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]
Line 84: Line 52:
 
[[Category:Japonica Chromosome 12]]
 
[[Category:Japonica Chromosome 12]]
 
[[Category:Chromosome 12]]
 
[[Category:Chromosome 12]]
 +
 +
==Structured Information==

Latest revision as of 09:18, 13 June 2015

OsCIPK04 is a member of CIPK genes (CIPKs,calcineurin B-like protein interacting protein kinases)[1].

Annotated Information

Function

The function of OsCIPK04 is specific to vegetative tissues/organs according to expression pattern. OsCIPK04 might function downstream of OsGI[1].

GO assignment(s): GO:0004672,GO:0004674, GO:0006468, GO:0005524, GO:0007165

Expression

Figure 1. Validation of diurnal expression patterns for OsCIPK04.(from reference [1]).
Figure 2. Down-regulation in response to drought stress were analyzed through real-time RT-PCR analysis.(from reference [1]).
  • OsCIPK04 showed down-regulation under drought stress(Fig. 1)[1].
  • Of the two genes in subgroup VII, OsCIPK04 showed preferred expression in the root and internode while OsCIPK07 showed high expression in the root, shoot, and leaf, which indicating that the function of both genes is specific to vegetative tissues/organs according to expression pattern[1].
  • OsCIPK04 peaked during the light period, the peak time of OsCIPK04 was a little earlier than that of OsCIPK07, suggesting the possibility of sequential regulation of circadian expression between them[1].
  • The x-axis indicates sampling time used for real-time RT-PCR analysis and the y-axis indicates the relative expression level to OsUbi5. 2 h drought stress treated seedling leaves for 2 h, 2hc control for 2 h, 4 h drought stress treated seedling leaves for 4 h, 4hc control for 4 h, 6 h drought stress treated seedling leaves for 6 h, 6hc control for 6 h, 8 h drought stress treated seedling leaves for 8 h, 8hc control for 8 h(Fig. 2)[1].
  • Real-time RT-PCR analysis confirmed the diurnal expression patterns showing a peak at daytime and a downregulation in the osgi mutant for the three marker genes and nine of the OsCIPK genes, OsCIPK04 is a member of these nine genes[1].

Evolution

OsCIPK04 and OsCIPK07 belongs to Group VII of OsCIPK family[1].

Knowledge Extension

Figure 3. Functional gene network analysis of OsCIPK family members.(from reference [1]).
  • From real-time RT-PCR analyses, Giong et al. identified 16 OsCIPK genes showing a significant up- or down-regulation in response to drought stress. Using the probable functional gene network tool, RiceNet, Giong et al. generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 3)[1].
  • More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 3) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 3) under drought stress to all the elements in this network[1].
  • Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 3)[1].
  • The calcineurin B-like protein–CBL-interacting protein kinase (CBL–CIPK) signaling pathway in plants is a Ca2+-related pathway that responds strongly to both abiotic and biotic environmental stimuli[2]. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells[2].

Labs working on this gene

  • Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
  • Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
  2. 2.0 2.1 Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.

Structured Information