|
|
| (24 intermediate revisions by 3 users not shown) |
| Line 1: |
Line 1: |
| − | Rice blast, caused by the fungus ''Magnaporthe oryzae'', is one of the most devastating diseases of rice. To understand the molecular basis of Pi5-mediated resistance to ''M. oryzae'', we cloned the resistance (R) gene at this locus using a map-based cloning strategy. Genetic and phenotypic analyses of 2014 F2 progeny from a mapping population derived from a cross between IR50, a susceptible rice cultivar, and the RIL260 line carrying Pi5 enabled us to narrow down the Pi5 locus to a 130-kb interval. Sequence analysis of this genomic region identified two candidate genes, Pi5-1 and Pi5-2, which encode proteins carrying three motifs characteristic of R genes: an N-terminal coiled-coil (CC) motif, a nucleotide-binding (NB) domain, and a leucine-rich repeat (LRR) motif. In genetic transformation experiments of a susceptible rice cultivar, neither the Pi5-1 nor the Pi5-2 gene was found to confer resistance to ''M. oryzae''. In contrast, transgenic rice plants expressing both of these genes, generated by crossing transgenic lines carrying each gene individually, conferred Pi5-mediated resistance to ''M. oryzae''. Gene expression analysis revealed that Pi5-1 transcripts accumulate after pathogen challenge, whereas the Pi5-2 gene is constitutively expressed. These results indicate that the presence of these two genes is required for rice Pi5-mediated resistance to ''M. oryzae''.
| + | |
| − | [[File:1.jpg]]
| + | Please input one-sentence summary here. |
| | + | |
| | + | ==Annotated Information== |
| | + | ===Function=== |
| | + | Please input function information here. |
| | + | |
| | + | ===Expression=== |
| | + | Please input expression information here. |
| | + | |
| | + | ===Evolution=== |
| | + | Please input evolution information here. |
| | + | |
| | + | You can also add sub-section(s) at will. |
| | + | |
| | + | ==Labs working on this gene== |
| | + | Please input related labs here. |
| | + | |
| | ==References== | | ==References== |
| − | <references>
| + | Please input cited references here. |
| − | <ref name="ref1">
| |
| − | S.Fukuoka;K.Okuno QTL analysis and mapping of pi21, a recessive gene for field resistance to rice blast in Japanese upland rice Theoretical and Applied Genetics, 2001, 103(2-3): 185-190
| |
| − | </ref>
| |
| − | <ref name="ref2">
| |
| − | Shuichi Fukuoka;Norikuni Saka;Hironori Koga;Kazuko Ono;Takehiko Shimizu;Kaworu Ebana;Nagao Hayashi;Akira Takahashi;Hirohiko Hirochika;Kazutoshi Okuno;Masahiro Yano Loss of Function of a Proline-Containing Protein Confers Durable Disease Resistance in Rice Science, 2009, 325(5943): 998-1001
| |
| − | </ref>
| |
| − | </references>
| |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 09]] |
| − | GeneName = Os04g0401000|
| |
| − | Description = Heavy metal transport/detoxification protein domain containing protein|
| |
| − | Version = NM_001059220.1 GI:115458169 GeneID:4335725|
| |
| − | Length = 1679 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os04g0401000, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
| |
| − | AP = Chromosome 4:19856181..19857859|
| |
| − | CDS = 19856474..19856539,19856708..19857192,19857329..19857410|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008397:19856181..19857859
| |
| − | source=RiceChromosome04
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008397:19856181..19857859
| |
| − | source=RiceChromosome04
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtga</cdnaseq>|
| |
| − | AA = <aaseq>MGILVILVDLQCCRCDAKIRKVLGCLEEEYCIEKVEYDVKNNRV IVRGKFDPEKLCKKIWCKAGKIIKEILIVDVWPPPLPQPPPPCKPPPCEKPPEDCKPK PCHCCSCEKPKPKPKPCHCEKPKPCHCEKPKPCEKPPPCKPEEPPKPPPEKPPPKPEC KLVPYPYPVPYPYAGQWCCPKPEPPKPPPPVCPPPPWCYTEDNANACSIM</aaseq>|
| |
| − | DNA = <dnaseqindica>1321..1386#668..1152#450..531#atgcatcgcctccattattcatgcttcgattctccatgctttcctctactgctcattggtaacattcggcaaatttgacaggtgagctcagtattttaaatcttaatgtagtactttggtgtgctaatctttgctctgttcaaaagagaattctggtttctttgctattttgaaaagagaattttcgttacaggacttcaacttccataatacttttttttataattaaggcatgatatatatcttctttctgaattccacgggaattgcactttttcctgagaaatttgtaaagagcatgcctgttaattgcaaggggcccctaactctgttatgagaaaagagaactatataagatgctcaataagcacctctttttttttttctgttaactgaccaaagcctgtctatctgcatttttttttgttttttgtttttcttgtgtgcagatgggtatattggtcatcttggtggacctgcaatgctgccgctgcgatgccaagatcaggaaggtcctgggctgccttgaaggtataataaattctgcccgaatcgtccatgtttgattgaattttcaaggctaatcagcagtgttcctgctcaattgggagcaaaacctctgttaaaaagggtgtgtttgaatgaatataattgaatatgaacgcagaggagtactgcatcgagaaggtggagtacgacgtgaagaacaacagggtgatcgtgcgcgggaagttcgacccggagaagctgtgcaagaagatctggtgcaaggccggcaagatcatcaaggagatcctcatcgtcgacgtctggccgccgccgctgccgcagccgccgccgccgtgcaagccgccgccgtgcgagaagcctccggaggactgcaagcccaagccctgccattgctgcagctgcgagaagcccaagcccaagcccaagccctgccactgcgagaagcccaagccctgtcactgcgagaagcccaagccatgcgagaagccgccgccgtgcaagccggaggagccgccgaagccgccgccggagaagccgccgccgaagccggagtgcaagctggtgccgtacccttacccggtgccgtacccgtacgccgggcagtggtgctgcccaaagcctgagccgccgaagccgccgccggagccaccgaaggagccggagccgccgaagccgtgcgggtgctcgcacgccttcgtgtgcgtctgcaagccggcgccgccgccgccgccgccgtgcgggtgctcggggggccacgggaactgcggctgcggcatcaggccgtggccgccgcaggtgtggccgccgccgcccgtctgcccgccgccgccgtggtgctacaccgaggacaacgccaacgcctgctccatcatgtgatggccggccggcggtcggcgtcgatcacgatcatctctgctgcttaatttccttgcttgctactacctctgctcctttccttgcctcggaaatcggaataaattaaacacgaggctgatcgatgtgtttgtaattaatccatggtgtttgtgttgtgtgctgtgtgggctgtataataattaattacagtatgttcatgtaaatttgtttgtttgtttgtttatgttgttcgatatgtataattatgtacaataattaatcgtggagaggctcactaaactcataaactgtag</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059220.1 RefSeq:Os04g0401000]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]]
| |
| − | [[Category:Japonica Chromosome 4]] | |
| − | [[Category:Chromosome 4]]
| |
