Difference between revisions of "Os02g0103800"

From RiceWiki
Jump to: navigation, search
(References)
 
(2 intermediate revisions by 2 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
 
 
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
* The stoichiometry of two '''''LFNR''''' isoforms('''''OsLFNR1''''' and '''''OsLFNR2''''') plays an important role in electron partitioning between carbon fixation and nitrogen assimilation<ref name="ref1" />.
 +
* Expression of '''''OsLFNR1''''' affected the nitrogen assimilation pathway without inhibition of photosynthesis under normal conditions<ref name="ref1" />.
 +
 
 +
===Mutation===
 +
[[File:LFNR-1.png|right|thumb|400px|'''Figure 1.''' ''Isolation of rice FOX Arabidopsis lines with altered chlorophyll
 +
fluorescence. A, The left panel shows Arabidopsis wild-type (WT) and T2 seedlings of K15006. The right panel shows a pseudocolor image of the NPQ. B, Plants of the wild type and the T2 generation of K15006 in the adult stage.<ref name="ref1" />.'']]
 +
 
 +
 
 +
[[File:LFNR-2.png|right|thumb|400px|'''Figure 2.''' ''Characterization of rice overexpression plants of OsLFNR1 <ref name="ref1" />.'']]
 +
* '''''OsLFNR1''''' expressed in Arabidopsis
 +
# Scientists isolated the rice FOX(for fulllength cDNA overexpressor) Arabidopsismutants K15006 with altered chlorophyll fluorescence kinetics. The phenotypes of K15006 was apparently caused by expression of the rice '''''LFNR1''''' gene. K15006 showed altered chlorophyll fluorescence. Figure 1A shows the seedling plants and false-color images of nonphotochemical quenching (NPQ) in K15006. The false colors show the minimum NPQ in blue and the maximum in red. The NPQs of K15006 were lower than in the wild type. K15006 exhibited pale green leaves at the seedling stage. As shown in Figure 1B, K15006 also exhibited growth defects and had paler green leaves in adult plants compared with the wild type. Chlorophyll content (μg chlorophyll mg-1 fresh weight) was lower in K15006 (1.32 ± 0.32) than in the wild type (1.73 ± 0.15). Concomitantly, a higher chlorophyll a/b ratio was observed in K15006 (3.51 ± 0.16) than in the wild type (3.13 ± 0.06)<ref name="ref1" />.
 +
# In K15006, endogenous expression of '''''AtLFNR1''''' and '''''AtLFNR2''''' might be affected by heterologous expression of the '''''OsLFNR''''' genes. The levels of '''''AtLFNR1''''' and '''''AtLFNR2''''' in K15006 decreased to 70% and 80% of those of the wild type, respectively. The results indicate that heterologous expression of '''''OsLFNR''''' fl-cDNAs results in a decreased level of '''''AtLFNR''''' mRNA in Arabidopsis<ref name="ref1" />.
 +
 
 +
*Overexpression of '''''OsLFNR1''''' Genes in Rice
 +
# Scientists observed 13 T0 transgenic plants of '''''OsLFNR1''''' ('''''OsLFNR1'''''-overexpression in rice) and found that three of them died and one plant was sterile, all of which showed a severe pale green phenotype. Rice T1 plants of OsLFNR1OE showed growth defects (Fig. 2A) when they were grown in soil<ref name="ref1" />.
 +
# Chlorophyll content (μg chlorophyll mg-1 fresh weight), when compared with that of the wild type (4.54 ± 0.62), was similar in OsLFNR1OE(4.34 ± 0.39). The ratio of chlorophyll a/b was slightly higher in OsLFNR1OE (3.61 ± 0.10) than in the wild type (3.52 ± 0.12)<ref name="ref1" />.
 +
# Quantitative real-time RT-PCR analysis suggests that overexpression of '''''OsLFNR1''''' gene causes the down-regulation of the endogenous '''''LFNR2''''' in rice as observed in the rice FOX Arabidopsis lines(K15006). Apparently, OsLFNR1OE accumulates more '''''OsLFNR1''''' and less '''''OsLFNR2''''', while OsLFNR2OE accumulates more '''''OsLFNR2''''' and less '''''OsLFNR1''''' compared with the wild type<ref name="ref1" />.
 +
#Proteins levels of '''''OsLFNR1''''' and '''''OsLFNR2''''' were determined by western blotting using the '''''FNR''''' antibody(Fig. 2D). Apparently, OsLFNR1OE accumulates more '''''OsLFNR1''''' and less '''''OsLFNR2''''' compared with the wild type<ref name="ref1" />.
 +
# The gene expression profiles of OsLFNR1OE was investigated by microarray analysis. Many genes encoding nucleus-encoded PSI subunits were down-regulated, and the expression of genes encoding PSII subunits also decreased in OsLFNR1OE. Genes other than those encoding the subunits of the photosystems were also down-regulated, such as genes encoding light-harvesting proteins, chlorophyll biosynthesis-related genes, the Rubisco small subunit, and thylakoid ascorbate peroxidase<ref name="ref1" />.
  
===Expression===
+
* '''''OsLFNR1'''''-Overexpressing Arabidopsis and Rice Plants did not alter photosynthetic activity under normal conditions<ref name="ref1" />.
Please input expression information here.
+
* The nitrate reduction pathway was affected in '''''OSLFNR1''''' overexpression rice plants<ref name="ref1" />.
  
===Evolution===
+
===Expression Pattern===
Please input evolution information here.
+
===Subcellular localization===
 +
===Alignment===
 +
* An alignment of '''''LFNR1''''' and '''''LFNR2''''' in rice and Arabidopsis is shown in Figure 3. Both in rice and Arabidopsis, '''''LFNR1''''' and '''''LFNR2''''' show high sequence identity at the amino acid level (80% identity between AtLFNR1 and '''''AtLFNR2''''', 80% identity between '''''OsLFNR1''''' and '''''OsLFNR2''''') except for the N-terminal amino acids, corresponding to the chloroplast transit peptide signal sequences. The identity between rice and Arabidopsis is also high in '''''LFNR1''''' and '''''LFNR2''''' (80% identity between '''''AtLFNR1''''' and '''''OsLFNR1''''', 82% identity between '''''AtLFNR2''''' and '''''OsLFNR2'''''). Several isoform-specific amino acids were seen as shown in the gray boxes<ref name="ref1" />.
 +
[[File:LFNR-alignment.png|center|thumb|400px|'''Figure 3.''' '' Amino acid sequence alignment of LFNR proteins in rice and
 +
Arabidopsis<ref name="ref1" />.'']]
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
* During photosynthesis, light energy is converted to chemical energy (in the form of ATP) through electron transport, and NADPH, a reducing agent, is also produced. In the final step of the linear electron transport of photosynthesis, ferredoxin NADP+-oxidoreductase ('''''FNR''''') catalyzes the reduction of NADP+ by ferredoxin (Fd) and provides the reducing power for CO2 fixation in the Calvin cycle. '''''FNR''''' is supposed to be one of the limiting factors in photosynthetic electron transport. Through the analysis of FNR antisense tobacco (Nicotiana tabacum) plants, the amount of FNR has been shown to correlate with photosynthetic activity.
 +
* '''''FNR''''' exists in a leaf form ('''''LFNR''''') and a root form <ref name="ref2" />. There are two '''''LFNR''''' proteins ('''''LFNR1 ''''' and '''''LFNR2''''') in the Arabidopsis (Arabidopsis thaliana) and rice (Oryza sativa) genomes. The overexpression of the '''''OsLFNR1''''' and '''''OsLFNR2''''' full-length cDNAs resulted in distinct phenotypes despite the high sequence similarity between them<ref name="ref1" />.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Plant Functional Genomics Research Group, RIKEN, Tsurumi-ku, Yokohama, Kanagawa 230–0045, Japan(M.H.-T., K.M., Y.H., M.K., M. Matsui)
 +
* Technology Center, Okinawa Institute of Science and Technology Promotion Corporation, Onna-son, Kunigami-gun, Okinawa 904–0412, Japan (T.I.);
 +
* Department of Applied Material and Life Science, Faculty of Engineering, Kanto Gakuin University, Kanazawa-ku, Yokohama, Kanagawa 236–8501, Japan (Y.K.);
 +
* Faculty of Education and Integrated Arts and Sciences, Waseda University, Shinjuku, Tokyo 162–8480, Japan (K.S.)
 +
* National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305–8602, Japan (M. Mori, H.H.)
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Higuchi-Takeuchi M, Ichikawa T, Kondou Y, Matsui K, Hasegawa Y, Kawashima M, Sonoike K, Mori M, Hirochika H, Matsui M. Functional analysis of two isoforms of leaf-type ferredoxin-NADP(+)-oxidoreductase in rice using the heterologous expression system of Arabidopsis. Plant Physiol. 2011 Sep;157(1):96-108. doi: 10.1104/pp.111.181248. Epub 2011 Jul 6. PubMed PMID: 21734114; PubMed Central PMCID: PMC3165901.
 +
</ref>
  
==Structured Information==
+
* <ref name="ref2">
{{JaponicaGene|
+
Hanke GT, Okutani S, Satomi Y, Takao T, Suzuki A, Hase T (2005) Multiple iso-proteins of FNR in Arabidopsis: evidence for different contributions to chloroplast function and nitrogen assimilation. Plant Cell Environ 28: 1146–1157
GeneName = Os02g0103800|
+
</ref>
Description = Similar to Ferredoxin NADP+ reductase (EC 1.18.1.2) (Fragment)|
+
</references>
Version = NM_001052143.1 GI:115443656 GeneID:4328000|
 
Length = 1641 bp|
 
Definition = Oryza sativa Japonica Group Os02g0103800, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
 
AP = Chromosome 2:183609..185249|
 
CDS = 183836..183903,183986..184150,184199..184453,184526..184604,184698..185183<br>|
 
GCID = <gbrowseImage1>
 
name=NC_008395:183609..185249
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008395:183609..185249
 
source=RiceChromosome02
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggccgccgtgaacacagtgtcgtcgctgccctgtagcaaagctggcgccgccgtagccgggggagctccgaggccgtcgacctgctccgtattctaccctcctcgttgctggtccaagcgaagcagcggtaatggcgtgcgggcgcaggcgtcgacgacggagacgaccgcagcgccggctgcggaggtgactactaaggtggagaaggtgtcgaagaagcaggtggatggcgtggtgacgaacaagtacaggcccaaggagccgtacacggggcggtgcctcctgaacacgaggatcaccggcgacgacgcccccggtgagacgtggcacatggtgttcagcaccgacggcgagatcccctaccgcgaggggcagtccatcggcgtcatccccgacggcatcgacaagaacggcaagccccacaagctccgcctctactccatcgccagcagcgccatcggggacttcgccgactccaagacggtatcgctgtgcgtgaagaggctggtgtacaccaacgatcagggagagatcgtcaaaggagtctgctccaacttcctctgtgacctgaagcctggttcggacgtgaagatcacggggccagtggggaaggagatgctgatgcccaaggaccccaacgccaccatcatcatgctgggcaccggcaccggcatcgcgcccttcaggtccttcctgtggaagatgttcttcgaggagcacgacgactacaagttcaacggcctggcgtggctcttcctcggggtgcccaccagcagcacgctgctgtacagggaggagttcgagcggatgaaggagacgaacgcggcgggggagaagatgtacatccagacgcggatggcggagtacaaggacgagctgtgggagctgctcaagaaggacaacacctacgtctacatgtgcggcctcaagggcatggagaaaggcatcgacgacatcatgatcgacctcgctgcaaaagacggcatcgactggcttgactacaagaagcagctgaagaagtcggagcaatggaatgtggaagtctactga</cdnaseq>|
 
AA = <aaseq>MAAVNTVSSLPCSKAGAAVAGGAPRPSTCSVFYPPRCWSKRSSG                    NGVRAQASTTETTAAPAAEVTTKVEKVSKKQVDGVVTNKYRPKEPYTGRCLLNTRITG                    DDAPGETWHMVFSTDGEIPYREGQSIGVIPDGIDKNGKPHKLRLYSIASSAIGDFADS                    KTVSLCVKRLVYTNDQGEIVKGVCSNFLCDLKPGSDVKITGPVGKEMLMPKDPNATII                    MLGTGTGIAPFRSFLWKMFFEEHDDYKFNGLAWLFLGVPTSSTLLYREEFERMKETNA                    AGEKMYIQTRMAEYKDELWELLKKDNTYVYMCGLKGMEKGIDDIMIDLAAKDGIDWLD                    YKKQLKKSEQWNVEVY</aaseq>|
 
DNA = <dnaseqindica>1347..1414#1100..1264#797..1051#646..724#67..552#actacaatcctctcctctcctctcctctcctctccttcctttgtcgcgagtcacaggcacacagacatggccgccgtgaacacagtgtcgtcgctgccctgtagcaaagctggcgccgccgtagccgggggagctccgaggccgtcgacctgctccgtattctaccctcctcgttgctggtccaagcgaagcagcggtaatggcgtgcgggcgcaggcgtcgacgacggagacgaccgcagcgccggctgcggaggtgactactaaggtggagaaggtgtcgaagaagcaggtggatggcgtggtgacgaacaagtacaggcccaaggagccgtacacggggcggtgcctcctgaacacgaggatcaccggcgacgacgcccccggtgagacgtggcacatggtgttcagcaccgacggcgagatcccctaccgcgaggggcagtccatcggcgtcatccccgacggcatcgacaagaacggcaagccccacaagctccgcctctactccatcgccagcagcgccatcggggacttcgccgactccaagacggtaactagctagtagtgtttttcttgctccatcgatctcaaccacaagacatgagctaactaacatcgacatcgtccctgatcgatcgatcaggtatcgctgtgcgtgaagaggctggtgtacaccaacgatcagggagagatcgtcaaaggagtctgctccaacttcctctgtaagctaggagtctgatcatgtaatagcagttagattgtacttgtgtgctaattaatggagtataatttaggtgacctgaagcctggttcggacgtgaagatcacggggccagtggggaaggagatgctgatgcccaaggaccccaacgccaccatcatcatgctgggcaccggcaccggcatcgcgcccttcaggtccttcctgtggaagatgttcttcgaggagcacgacgactacaagttcaacggcctggcgtggctcttcctcggggtgcccaccagcagcacgctgctgtacagggaggagttcgagcggatgaaggagatcgcgccggagaggttccggctggacttcgcggtgagccgggagcagacgaacgcggcgggggagaagatgtacatccagacgcggatggcggagtacaaggacgagctgtgggagctgctcaagaaggacaacacctacgtctacatgtgcggcctcaagggcatggagaaaggcatcgacgacatcatgatcgacctcgctgcaaaagacggtactgtactagtacttcttttaatctccatctctattcgattcctaattactttctttcttgcattatatactgtatgtaggcatcgactggcttgactacaagaagcagctgaagaagtcggagcaatggaatgtggaagtctactgatggatatatatatgttaataattaattaatccctttttatctcgattttcatgcatgcatgcgcaacctgcatacgccatcttgttgtactcgatctgatctcatctgatgagatgcatgtagatattatactgacgattcgtcgactataaagtggtttcccattttctgctgtattttgacaactttagtgtcccatttatttattatatatgcgcatgtgaatt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052143.1 RefSeq:Os02g0103800]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 

Latest revision as of 06:12, 12 June 2016

Annotated Information

Function

  • The stoichiometry of two LFNR isoforms(OsLFNR1 and OsLFNR2) plays an important role in electron partitioning between carbon fixation and nitrogen assimilation[1].
  • Expression of OsLFNR1 affected the nitrogen assimilation pathway without inhibition of photosynthesis under normal conditions[1].

Mutation

Figure 1. Isolation of rice FOX Arabidopsis lines with altered chlorophyll fluorescence. A, The left panel shows Arabidopsis wild-type (WT) and T2 seedlings of K15006. The right panel shows a pseudocolor image of the NPQ. B, Plants of the wild type and the T2 generation of K15006 in the adult stage.[1].


Figure 2. Characterization of rice overexpression plants of OsLFNR1 [1].
  • OsLFNR1 expressed in Arabidopsis
  1. Scientists isolated the rice FOX(for fulllength cDNA overexpressor) Arabidopsismutants K15006 with altered chlorophyll fluorescence kinetics. The phenotypes of K15006 was apparently caused by expression of the rice LFNR1 gene. K15006 showed altered chlorophyll fluorescence. Figure 1A shows the seedling plants and false-color images of nonphotochemical quenching (NPQ) in K15006. The false colors show the minimum NPQ in blue and the maximum in red. The NPQs of K15006 were lower than in the wild type. K15006 exhibited pale green leaves at the seedling stage. As shown in Figure 1B, K15006 also exhibited growth defects and had paler green leaves in adult plants compared with the wild type. Chlorophyll content (μg chlorophyll mg-1 fresh weight) was lower in K15006 (1.32 ± 0.32) than in the wild type (1.73 ± 0.15). Concomitantly, a higher chlorophyll a/b ratio was observed in K15006 (3.51 ± 0.16) than in the wild type (3.13 ± 0.06)[1].
  2. In K15006, endogenous expression of AtLFNR1 and AtLFNR2 might be affected by heterologous expression of the OsLFNR genes. The levels of AtLFNR1 and AtLFNR2 in K15006 decreased to 70% and 80% of those of the wild type, respectively. The results indicate that heterologous expression of OsLFNR fl-cDNAs results in a decreased level of AtLFNR mRNA in Arabidopsis[1].
  • Overexpression of OsLFNR1 Genes in Rice
  1. Scientists observed 13 T0 transgenic plants of OsLFNR1 (OsLFNR1-overexpression in rice) and found that three of them died and one plant was sterile, all of which showed a severe pale green phenotype. Rice T1 plants of OsLFNR1OE showed growth defects (Fig. 2A) when they were grown in soil[1].
  2. Chlorophyll content (μg chlorophyll mg-1 fresh weight), when compared with that of the wild type (4.54 ± 0.62), was similar in OsLFNR1OE(4.34 ± 0.39). The ratio of chlorophyll a/b was slightly higher in OsLFNR1OE (3.61 ± 0.10) than in the wild type (3.52 ± 0.12)[1].
  3. Quantitative real-time RT-PCR analysis suggests that overexpression of OsLFNR1 gene causes the down-regulation of the endogenous LFNR2 in rice as observed in the rice FOX Arabidopsis lines(K15006). Apparently, OsLFNR1OE accumulates more OsLFNR1 and less OsLFNR2, while OsLFNR2OE accumulates more OsLFNR2 and less OsLFNR1 compared with the wild type[1].
  4. Proteins levels of OsLFNR1 and OsLFNR2 were determined by western blotting using the FNR antibody(Fig. 2D). Apparently, OsLFNR1OE accumulates more OsLFNR1 and less OsLFNR2 compared with the wild type[1].
  5. The gene expression profiles of OsLFNR1OE was investigated by microarray analysis. Many genes encoding nucleus-encoded PSI subunits were down-regulated, and the expression of genes encoding PSII subunits also decreased in OsLFNR1OE. Genes other than those encoding the subunits of the photosystems were also down-regulated, such as genes encoding light-harvesting proteins, chlorophyll biosynthesis-related genes, the Rubisco small subunit, and thylakoid ascorbate peroxidase[1].
  • OsLFNR1-Overexpressing Arabidopsis and Rice Plants did not alter photosynthetic activity under normal conditions[1].
  • The nitrate reduction pathway was affected in OSLFNR1 overexpression rice plants[1].

Expression Pattern

Subcellular localization

Alignment

  • An alignment of LFNR1 and LFNR2 in rice and Arabidopsis is shown in Figure 3. Both in rice and Arabidopsis, LFNR1 and LFNR2 show high sequence identity at the amino acid level (80% identity between AtLFNR1 and AtLFNR2, 80% identity between OsLFNR1 and OsLFNR2) except for the N-terminal amino acids, corresponding to the chloroplast transit peptide signal sequences. The identity between rice and Arabidopsis is also high in LFNR1 and LFNR2 (80% identity between AtLFNR1 and OsLFNR1, 82% identity between AtLFNR2 and OsLFNR2). Several isoform-specific amino acids were seen as shown in the gray boxes[1].
Figure 3. Amino acid sequence alignment of LFNR proteins in rice and Arabidopsis[1].

Knowledge Extension

  • During photosynthesis, light energy is converted to chemical energy (in the form of ATP) through electron transport, and NADPH, a reducing agent, is also produced. In the final step of the linear electron transport of photosynthesis, ferredoxin NADP+-oxidoreductase (FNR) catalyzes the reduction of NADP+ by ferredoxin (Fd) and provides the reducing power for CO2 fixation in the Calvin cycle. FNR is supposed to be one of the limiting factors in photosynthetic electron transport. Through the analysis of FNR antisense tobacco (Nicotiana tabacum) plants, the amount of FNR has been shown to correlate with photosynthetic activity.
  • FNR exists in a leaf form (LFNR) and a root form [2]. There are two LFNR proteins (LFNR1 and LFNR2) in the Arabidopsis (Arabidopsis thaliana) and rice (Oryza sativa) genomes. The overexpression of the OsLFNR1 and OsLFNR2 full-length cDNAs resulted in distinct phenotypes despite the high sequence similarity between them[1].

Labs working on this gene

  • Plant Functional Genomics Research Group, RIKEN, Tsurumi-ku, Yokohama, Kanagawa 230–0045, Japan(M.H.-T., K.M., Y.H., M.K., M. Matsui)
  • Technology Center, Okinawa Institute of Science and Technology Promotion Corporation, Onna-son, Kunigami-gun, Okinawa 904–0412, Japan (T.I.);
  • Department of Applied Material and Life Science, Faculty of Engineering, Kanto Gakuin University, Kanazawa-ku, Yokohama, Kanagawa 236–8501, Japan (Y.K.);
  • Faculty of Education and Integrated Arts and Sciences, Waseda University, Shinjuku, Tokyo 162–8480, Japan (K.S.)
  • National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305–8602, Japan (M. Mori, H.H.)

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 Higuchi-Takeuchi M, Ichikawa T, Kondou Y, Matsui K, Hasegawa Y, Kawashima M, Sonoike K, Mori M, Hirochika H, Matsui M. Functional analysis of two isoforms of leaf-type ferredoxin-NADP(+)-oxidoreductase in rice using the heterologous expression system of Arabidopsis. Plant Physiol. 2011 Sep;157(1):96-108. doi: 10.1104/pp.111.181248. Epub 2011 Jul 6. PubMed PMID: 21734114; PubMed Central PMCID: PMC3165901.
  2. Hanke GT, Okutani S, Satomi Y, Takao T, Suzuki A, Hase T (2005) Multiple iso-proteins of FNR in Arabidopsis: evidence for different contributions to chloroplast function and nitrogen assimilation. Plant Cell Environ 28: 1146–1157