Difference between revisions of "Os03g0401300"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
 
(One intermediate revision by the same user not shown)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
Sus 2
+
 
 
===Function===
 
===Function===
 
In rice three genes encoding for sucrose synthase (Sus) (EC 2.4.1.13) have previously been characterized, and a further three sequences for putative Sus genes reported. The current work confirms that these six genes comprise the entire rice Sus gene family. An expression analysis was conducted in various rice tissues using real-time quantitative RT-PCR. Sus transcripts were detected in a wide range of tissues and at different developmental stages, indicating that Sus is involved in numerous and diverse growth processes in the rice plant. SUS1 was predominantly expressed in elongating tissues including roots, developing leaves and internodes; a potential role for SUS1 in cellulose synthesis is discussed. SUS2 was shown to be expressed in a wide range of tissues, suggesting that it may perform a number of housekeeping role(s). In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence.
 
In rice three genes encoding for sucrose synthase (Sus) (EC 2.4.1.13) have previously been characterized, and a further three sequences for putative Sus genes reported. The current work confirms that these six genes comprise the entire rice Sus gene family. An expression analysis was conducted in various rice tissues using real-time quantitative RT-PCR. Sus transcripts were detected in a wide range of tissues and at different developmental stages, indicating that Sus is involved in numerous and diverse growth processes in the rice plant. SUS1 was predominantly expressed in elongating tissues including roots, developing leaves and internodes; a potential role for SUS1 in cellulose synthesis is discussed. SUS2 was shown to be expressed in a wide range of tissues, suggesting that it may perform a number of housekeeping role(s). In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence.
Line 13: Line 13:
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
  
 
==Structured Information==
 
==Structured Information==
Line 58: Line 52:
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Japonica Chromosome 3]]
 
[[Category:Chromosome 3]]
 
[[Category:Chromosome 3]]
 +
 +
==Labs working on this gene==
 +
Please input related labs here.
 +
 +
==References==
 +
Please input cited references here.

Latest revision as of 10:04, 25 June 2016

Please input one-sentence summary here.

Annotated Information

Function

In rice three genes encoding for sucrose synthase (Sus) (EC 2.4.1.13) have previously been characterized, and a further three sequences for putative Sus genes reported. The current work confirms that these six genes comprise the entire rice Sus gene family. An expression analysis was conducted in various rice tissues using real-time quantitative RT-PCR. Sus transcripts were detected in a wide range of tissues and at different developmental stages, indicating that Sus is involved in numerous and diverse growth processes in the rice plant. SUS1 was predominantly expressed in elongating tissues including roots, developing leaves and internodes; a potential role for SUS1 in cellulose synthesis is discussed. SUS2 was shown to be expressed in a wide range of tissues, suggesting that it may perform a number of housekeeping role(s). In addition, overall Sus activity and expression of SUS2 increased significantly in seedlings germinated and grown in hypoxia (submerged conditions), suggesting a role in increasing sucrose metabolism as a response to environmental stress. SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain. Transcript levels of SUS5 and SUS6 were low in all tissues examined, and were suppressed in germinating shoots under submergence.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Structured Information

Gene Name

Os03g0401300

Description

Sucrose synthase 2 (EC 2.4.1.13) (Sucrose-UDP glucosyltransferase 2)

Version

NM_001056854.1 GI:115453436 GeneID:4333062

Length

4811 bp

Definition

Oryza sativa Japonica Group Os03g0401300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:16852236..16857046

Sequence Coding Region

16852660..16852846,16852941..16853185,16853284..16853602,16853689..16853913,16854018..16854184
,16854268..16854384,16854472..16854645,16854727..16854822,16854907..16855123
,16855243..16855361,16855487..16855679,16855800..16855951,16856047..16856176
,16856905..16857014

Expression

GEO Profiles:Os03g0401300

Genome Context

<gbrowseImage1> name=NC_008396:16852236..16857046 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:16852236..16857046 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggggaagctgccggcgaccgcgtcctgagccgcctccacagcgtcagggagcgcatcggcgactccctctccgcccaccccaatgagctcgtcgccgtcttcaccaggctggttaacctcggaaagggaatgcttcaggcccaccagatcattgctgagtacaacaacgcaatctctgaggctgatcgtgagaagctgaaggacggtgcttttgaggatgtcctgaggagtgcacaggaggggattgttatctccccatgggttgcccttgccatccgcccgaggcccggtgtctgggagtatgtgagggtcaatgtgagcgagctcgctgttgagttgctgacagtccccgagtacttgcagttcaaggaacagcttgtggaagaaggcaccaacaacaactttgtgcttgagctggatttcgagccattcaatgcctccttccctcgtccttctctgtcgaagtccattggcaatggtgtgcagttcctcaacaggcatctgtcatcgaagctcttccatgacaaggagagcatgtacccactgctcaacttccttcgtgcacacaactacaagggcatgaccatgatgttgaatgacagaatccgcagtctcagtgctctccaaggtgctctgaggaaggctgaggagcatctttctggtctttcagcagacaccccttactcagaattccaccacaggttccaggaacttggtctggagaagggttggggtgactgtgccaagcgttcccaggagaccattcacctccttttggaccttcttgaggcccctgatccgtccaccctcgagaagttccttggaacaatcccaatggtgttcaatgttgtcattatgtccccacacggttacttcgcgcaagccaatgtcttgggttaccctgacactggagggcaggttgtctacattttggaccaagtccgtgctatggagaatgagatgcttctgaggatcaagcagcaaggtctcaatattacaccacgcatccttattgtcaccaggttgctccctgatgcaactggcaccacctgcggtcagcgtcttgagaaggtccttggcaccgagcacacccacatcctacgtgtgcctttcagaactgaaaatggaattgttcgcaagtggatctcacgttttgaagtctggccgtacctggaaacattcactgatgatgtcgcgcacgaaattgctggagagctccaggccaatcctgacttgatcatcggaaactacagtgacggaaaccttgttgcatgcttgcttgcacacaagatgggtgttacccattgtaccattgcccatgcgcttgagaaaaccaagtaccccaactctgacctctactggaagaagtttgaggatcactaccacttctcatgccagttcacaactgacttgattgcgatgaaccacgctgacttcatcatcaccagtaccttccaagagattgccggaaacaaggacactgttggtcagtatgagtctcacatggcattcaccatgcctggtctgtaccgtgttgtccacggtattgatgtttttgacccgaagtttaacattgtctcgcctggtgcggacatgtccatctacttcccttactctgagtctcgtaagaggctcacctccctccacccagagattgaggagttgctctacagcgaagttgacaacaacgagcacaagtttatgctgaaggacaggaacaagccaatcatcttctccatggctcgtcttgaccgtgtcaagaacttgactggtctggttgagctgtatggtcgcaaccctcgcctgcaagagctggttaaccttgtggttgtctgtggtgaccatggcaacccatctaaggacaaggaggagcaggctgagttcaagaagatgtttgaccttattgagcaatacaacttgaatggccacatccgctggatctccgcgcagatgaaccgtgtccgcaacggtgagctctaccgttacatctgcgacaccaagggtgcttttgtgcagcccgctttctacgaggcattcggtctcactgttgttgagtccatgacctgtggtctcccgacattcgcaaccgcctatggtggtccagctgagatcatcgtgaacggagtgtctggcttccacattgacccataccagggtgacaaggcctcggcgctgctcgttgagttctttgagaagtgccaggaagaccccagccactggaccaagatctcgcagggcggtcttcagcgtatcgaggagaaatacacctggaagctctactctgagaggctgatgaccctcaccggcgtctacggattctggaagtacgtctcgaacctggagaggcgtgaaacccgccgctaccttgagatgctgtatgccctcaagtaccgcaccatggctagcaccgtcccgttggccgtcgagggcgagccgtcgaacaagtga</cdnaseq>

Protein Sequence

<aaseq>MGEAAGDRVLSRLHSVRERIGDSLSAHPNELVAVFTRLVNLGKG MLQAHQIIAEYNNAISEADREKLKDGAFEDVLRSAQEGIVISPWVALAIRPRPGVWEY VRVNVSELAVELLTVPEYLQFKEQLVEEGTNNNFVLELDFEPFNASFPRPSLSKSIGN GVQFLNRHLSSKLFHDKESMYPLLNFLRAHNYKGMTMMLNDRIRSLSALQGALRKAEE HLSGLSADTPYSEFHHRFQELGLEKGWGDCAKRSQETIHLLLDLLEAPDPSTLEKFLG TIPMVFNVVIMSPHGYFAQANVLGYPDTGGQVVYILDQVRAMENEMLLRIKQQGLNIT PRILIVTRLLPDATGTTCGQRLEKVLGTEHTHILRVPFRTENGIVRKWISRFEVWPYL ETFTDDVAHEIAGELQANPDLIIGNYSDGNLVACLLAHKMGVTHCTIAHALEKTKYPN SDLYWKKFEDHYHFSCQFTTDLIAMNHADFIITSTFQEIAGNKDTVGQYESHMAFTMP GLYRVVHGIDVFDPKFNIVSPGADMSIYFPYSESRKRLTSLHPEIEELLYSEVDNNEH KFMLKDRNKPIIFSMARLDRVKNLTGLVELYGRNPRLQELVNLVVVCGDHGNPSKDKE EQAEFKKMFDLIEQYNLNGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAFYEAFGL TVVESMTCGLPTFATAYGGPAEIIVNGVSGFHIDPYQGDKASALLVEFFEKCQEDPSH WTKISQGGLQRIEEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMLYALKY RTMASTVPLAVEGEPSNK</aaseq>

Gene Sequence

<dnaseqindica>4201..4387#3862..4106#3445..3763#3134..3358#2863..3029#2663..2779#2402..2575#2225..2320#1924..2140#1686..1804#1368..1560#1096..1247#871..1000#33..142#aggcttgaggagccaagaggaagaggagagcaatgggggaagctgccggcgaccgcgtcctgagccgcctccacagcgtcagggagcgcatcggcgactccctctccgcccaccccaatgagctcgtcgccgtcttcaccaggttcgtgctgatttagtgatttcccagcattagattttgttggtttctagtctactgccttcagatgttactgtattttcttttagaaggagatgttcatataggatctttgttgttgagattgttagatctggccaggaatggctcatatttactgaattggatgcaatcattttgtagtcactttttttttaagtttctgattagaatgaatatttaagtgcggccttctgcagccaagattttgtacaaacctagtactactgaataatgatgaaatatacaaatgtagttttggattactgtggactggtagtgctagatctgactgcatgtgcatgttatttatattatatatacggtttacaaactgaatacaagtaatgaattctgcactggtacagatgcttgttgtggtagcaaagtttcacaaaaaaaataaaaaacctacatcttactagatctattggcgcgagcgcgtagatctgattatcgcgcatatttcattaagtccaattaaatggtcaaaactaatcatttcatatctacaatgaaatttttaattcatctcaatgcaaacagatcatatatggtctttttaagtggctaatagcaaattttcttattatgcgcaaatgctcaagtgctaaaattatcttattgagatatttataggctgagttgatagatctggcctgatatttttgttgacactgttatttgcgcaggctggttaacctcggaaagggaatgcttcaggcccaccagatcattgctgagtacaacaacgcaatctctgaggctgatcgtgagaagctgaaggacggtgcttttgaggatgtcctgaggagtgcacaggtttgaatcagattcagatttcattgcatcacagagatccatctttactctaccgcttgctctaacttaacttgtaattgttttttatcatgcaggaggggattgttatctccccatgggttgcccttgccatccgcccgaggcccggtgtctgggagtatgtgagggtcaatgtgagcgagctcgctgttgagttgctgacagtccccgagtacttgcagttcaaggaacagcttgtggaagaagggtatgaaatctgcataattgggatactaaaaacatatattcttaaaatttaaaacttaattttattatttttcttttatcgatatatatgtcattgtaatatctctgatgtatatttcagcaccaacaacaactttgtgcttgagctggatttcgagccattcaatgcctccttccctcgtccttctctgtcgaagtccattggcaatggtgtgcagttcctcaacaggcatctgtcatcgaagctcttccatgacaaggagagcatgtacccactgctcaacttccttcgtgcacacaactacaagggcatggtaaggcagcttcatactatttcctcatctcacatttttgtactatggcatattaacatgaattgaattgattttgagatggaagtataaattctgaatggatggaatatatattttttctgcagaccatgatgttgaatgacagaatccgcagtctcagtgctctccaaggtgctctgaggaaggctgaggagcatctttctggtctttcagcagacaccccttactcagaattccaccacaggtactgataattattttttacatattatgaactctagaatgtattttgatatgaaaccaccgaagatattttgccagtattgttgtgactaaaaatgaccatttgattggaaaatacaggttccaggaacttggtctggagaagggttggggtgactgtgccaagcgttcccaggagaccattcacctccttttggaccttcttgaggcccctgatccgtccaccctcgagaagttccttggaacaatcccaatggtgttcaatgttgtcattatgtccccacacggttacttcgcgcaagccaatgtcttgggttaccctgacactggagggcaggtagaattcttaattttgacatttgttcatacttaaaaaaattaaacctgttctcattattctttgtgctatgattaccgaaaggttgtctacattttggaccaagtccgtgctatggagaatgagatgcttctgaggatcaagcagcaaggtctcaatattacaccacgcatccttattgtaagtgggatacctgatatggtgcaatacaacttgtcagctatagcaatatgatatttaaccttctttggtcttgaacaggtcaccaggttgctccctgatgcaactggcaccacctgcggtcagcgtcttgagaaggtccttggcaccgagcacacccacatcctacgtgtgcctttcagaactgaaaatggaattgttcgcaagtggatctcacgttttgaagtctggccgtacctggaaacattcactgatgtagatacctaacctcgctgtcacaccttcttggttattcatttattaaagataaacttcatattgactctttcccatggatgtcaggatgtcgcgcacgaaattgctggagagctccaggccaatcctgacttgatcatcggaaactacagtgacggaaaccttgttgcatgcttgcttgcacacaagatgggtgttacccatgtacgcattttgactactctgatcagaagtgttttaactacatatttgctcattctcatgttgccttgttccatgatatgcagtgtaccattgcccatgcgcttgagaaaaccaagtaccccaactctgacctctactggaagaagtttgaggatcactaccacttctcatgccagttcacaactgacttgattgcgatgaaccacgctgacttcatcatcaccagtaccttccaagagattgccggaaagtaatatttctatacaactaaagttttctgggtcacatccgtcagttatgtcgtaaaaatgcaattacctttccatgatctaatggcattttctggtttttcagcaaggacactgttggtcagtatgagtctcacatggcattcaccatgcctggtctgtaccgtgttgtccacggtattgatgtttttgacccgaagtttaacattgtctcgcctggtgcggacatgtccatctacttcccttactctgagtctcgtaagaggctcacctccctccacccagagattgaggagttgctctacagcgaagttgacaacaacgagcacaagtaagaagcggtttttacatagctcgatctacattcatctgatgcatgtcgccctcattatctgactagaatactctctgcaacaggtttatgctgaaggacaggaacaagccaatcatcttctccatggctcgtcttgaccgtgtcaagaacttgactggtctggttgagctgtatggtcgcaaccctcgcctgcaagagctggttaaccttgtggttgtctgtggtgaccatggcaacccatctaaggacaaggaggagcaggctgagttcaagaagatgtttgaccttattgagcaatacaacttgaatggccacatccgctggatctccgcgcagatgaaccgtgtccgcaacggtgagctctaccgttacatctgcgacaccaagggtgcttttgtgcaggtaacttaatgatgttctctcattgcaaaaatatcatggttgaatacttgaattgtaaatctaactgttctcaaatttatcttgtcttgcgtttccagcccgctttctacgaggcattcggtctcactgttgttgagtccatgacctgtggtctcccgacattcgcaaccgcctatggtggtccagctgagatcatcgtgaacggagtgtctggcttccacattgacccataccagggtgacaaggcctcggcgctgctcgttgagttctttgagaagtgccaggaagaccccagccactggaccaagatctcgcagggcggtcttcagcgtatcgaggagaagtatgcaaaacacatcccagtaatctgtgtttctgaatacgcatttcgtctttcttgcagtgctaacattatgtttctccaacctttgtttcagatacacctggaagctctactctgagaggctgatgaccctcaccggcgtctacggattctggaagtacgtctcgaacctggagaggcgtgaaacccgccgctaccttgagatgctgtatgccctcaagtaccgcaccatggctagcaccgtcccgttggccgtcgagggcgagccgtcgaacaagtgagctggccaacatctcaggctgagactctgaaagaggagagcattggagtttctttgctttgtttccattctctggtttcagagatgaaaagagaagagagatatttcaggatgctttgcattcctaggcactgctctttttccttaagaaagtaaggtcgattgaatttgggagttttctagtttgatttagttgggggtgagttcagtggaatgtggtgtgtggttggtgctctgtctcctcttgttattgggatgttacctatgaataatagaaacggccttggtgccgtttctgcaataatatattgtagcatccttgtttccaagaaaaaattgtcactgaaatgctcacttctccttggggttatcttactgtttatttatgtttcaccaatcgaaatccttactgtgcatctttgact</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0401300, RefSeq:Os03g0401300

Labs working on this gene

Please input related labs here.

References

Please input cited references here.