|
|
| (4 intermediate revisions by 2 users not shown) |
| Line 3: |
Line 3: |
| | ==Annotated Information== | | ==Annotated Information== |
| | ===Function=== | | ===Function=== |
| − | Please input function information here.
| |
| − |
| |
| | Heat stress transcription factors (Hsfs) are the central regulators of defense response to heat stress. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to | | Heat stress transcription factors (Hsfs) are the central regulators of defense response to heat stress. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to |
| | their protein structures[1]. HsfB1 is one gene of the HsfB which consists of 8 genes. plant Hsfs diversify in their biological functions[2][3]. HsfA members are capable of transcriptional activation, while HsfB members act as repressors or as co-activators (e.g., HsfB1) of HsfA members. Overexpression of Hsf genes in transgenic plants resulted in an up-regulation of heat stress-associated genes and an enhancement of thermotolerance, whereas the down-regulation of Hsf genes leads to a reduction in the thermotolerance[4][5]. In addition to control of heat stress response, Hsfs have also been reported to be involved in the defense response to pathogen attack, oxidative stress, heavy metals, dehydration and salinity, and in certain processes of development and differentiation[6]. | | their protein structures[1]. HsfB1 is one gene of the HsfB which consists of 8 genes. plant Hsfs diversify in their biological functions[2][3]. HsfA members are capable of transcriptional activation, while HsfB members act as repressors or as co-activators (e.g., HsfB1) of HsfA members. Overexpression of Hsf genes in transgenic plants resulted in an up-regulation of heat stress-associated genes and an enhancement of thermotolerance, whereas the down-regulation of Hsf genes leads to a reduction in the thermotolerance[4][5]. In addition to control of heat stress response, Hsfs have also been reported to be involved in the defense response to pathogen attack, oxidative stress, heavy metals, dehydration and salinity, and in certain processes of development and differentiation[6]. |
| | | | |
| | ===Expression=== | | ===Expression=== |
| − | Please input expression information here.
| + | Chuang wang[7] detect the expression patterns of OsHsfs in rice. They find the majority of OsHsf genes have a low to moderate level in most tissues, while some display a tissue-specific manner (Fig.1). For example HsfB1, than other genes has a relative heavy level in the tissues of root and seed. Chuang wang also studys the Cis-acting elements in OsHsf promoters. They find 9 different Cis-acting elements in total. One of the Cis-acting element,ARE and GC-motif involved in the anaerobic induction, has a high number of 4 in the HsfB1. We can suppose that the high level of HsfB1 in seed and root and the high level of ARE and GC-motif are adaptive to the environment for rice. |
| − | | |
| − | Chuang wang[7] detected the expression patterns of OsHsfs in rice. They found The majority of OsHsf genes had a low to moderate level in most tissues, while some displayed a tissue-specific manner (Fig.1). For example HsfB1, than other genes has a relative heavy level in the tissues of root and seed. Chuang wang also studied the Cis-acting elements in OsHsf promoters. They found 9 different Cis-acting elements in total. One of the Cis-acting element,ARE and GC-motif involved in the anaerobic induction, has a high number of 4 in the HsfB1. We can suppose that the high level of HsfB1 in seed and root and the high level of ARE and GC-motif are adaptive to the environment for rice. | |
| | [[File:123.jpg]] | | [[File:123.jpg]] |
| | | | |
| | ===Evolution=== | | ===Evolution=== |
| − | Please input evolution information here.
| |
| − |
| |
| | You can also add sub-section(s) at will. | | You can also add sub-section(s) at will. |
| | | | |
| Line 24: |
Line 18: |
| | | | |
| | ==Labs working on this gene== | | ==Labs working on this gene== |
| − | Please input related labs here.
| + | Here some labs studing the OsHsfs, not the only OsHsfB1,are provided: |
| | + | |
| | + | 1 State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science,Zhejiang University, Hangzhou 310058, China. |
| | + | |
| | + | 2 Department of Molecular Cell Biology, Biocenter of the Goethe University, Germany. |
| | + | |
| | + | 3 Microbiology and Cell Science Department, Program of Plant Molecular and Cellular Biology, University of Florida, Bldg. 981, Gainesville. |
| | | | |
| | ==References== | | ==References== |
| − | Please input cited references here.
| |
| | | | |
| | 1 Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A., Scharf, K.D., 2001. Arabidopsisand the heat stress tran scription factor world: how many heat stress transcription factors do we need? Cell Stress Chaperones, 6(3): 177-189. | | 1 Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A., Scharf, K.D., 2001. Arabidopsisand the heat stress tran scription factor world: how many heat stress transcription factors do we need? Cell Stress Chaperones, 6(3): 177-189. |
| Line 41: |
Line 40: |
| | 6 Larkindale, J., Hall, J.D., Knight, M.R., Vierling, E., 2005. Heat stress phenotypes of Arabidopsis mutants implicate multiple signaling pathways in the acquisition of thermotolerance. Plant Physiol., 138(2):882-897. | | 6 Larkindale, J., Hall, J.D., Knight, M.R., Vierling, E., 2005. Heat stress phenotypes of Arabidopsis mutants implicate multiple signaling pathways in the acquisition of thermotolerance. Plant Physiol., 138(2):882-897. |
| | | | |
| − | 7 Chuang WANG, Qian ZHANG, Hui-xia SHOU. Identification and expression analysis of OsHsfs in rice. Journal of Zhejiang University SCIENCE B 2009 10(4):291-300 | + | 7 Chuang WANG, Qian ZHANG, Hui-xia SHOU. Identification and expression analysis of OsHsfs in rice. Journal of Zhejiang University SCIENCE B 2009 10(4):291-300. |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os09g0456800|
| |
| − | Description = Similar to Heat stress transcription factor Spl7 (Heat shock transcription factor) (Heat shock factor RHSF10)|
| |
| − | Version = NM_001069899.1 GI:115479540 GeneID:4347259|
| |
| − | Length = 7445 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os09g0456800, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
| |
| − | AP = Chromosome 9:17875190..17882634|
| |
| − | CDS = 17875536..17875802,17881683..17882324|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008402:17875190..17882634
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008402:17875190..17882634
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggctgctgctgaggcggcggcggcggtggggaagcagcagcagaagggcggcgggggaaggggaggaggcggcggtgggccggcgccgttcctgacgaagacgaaccagatggtggaggagagcgcgacggacgaggtgatctcgtggggaaaggaggggcggtcgttcgtggtgtggaagccggtggagttcgcccgcgacctcctcccgctccacttcaagcactgcaacttctcctccttcgtccgccagctcaacacctacggtttccggaaggtggtgcccgatcggtgggagttcgccaacggcaacttccggcgaggagagcaaggcctcctctccggcatccgccgccgcaaggcgacgacgcctcagtcctccaaatcctgcggcagcggcgtcaacgtcgcgttccctccgccgctgccccctctgcccccggagccgtcggcgaccacgtccagcggcaacgaccgcagctcctcctccgcgtcctcgccgccgcgggcggacatcaccagcgagaacgagcagctcaggaaggacaaccaaacgctgacgatggagctggcgcgggctcggcggcactgcgaggagcttctgggcttcctgtcgcgcttcctcgacgtccggcagctcgatctccggctgctcatgcaggaagacatgcgagcggcggccggcggcgtcggcggcgagcagcgcgtgcaagagcacgcccgggaggagaagtgcgtgaagctgttcggcgtgctcctcgacgacacccatggcgccgccacgaggaagagggcgcggtgcgaggaggcggctgccagcgagcggccgatcaagatgatcaggatcggcgagccgtgggtcagcgttccatcgtcggggccggcgcggtgtggcggcgacaactga</cdnaseq>|
| |
| − | AA = <aaseq>MAAAEAAAAVGKQQQKGGGGRGGGGGGPAPFLTKTNQMVEESAT DEVISWGKEGRSFVVWKPVEFARDLLPLHFKHCNFSSFVRQLNTYGFRKVVPDRWEFA NGNFRRGEQGLLSGIRRRKATTPQSSKSCGSGVNVAFPPPLPPLPPEPSATTSSGNDR SSSSASSPPRADITSENEQLRKDNQTLTMELARARRHCEELLGFLSRFLDVRQLDLRL LMQEDMRAAAGGVGGEQRVQEHAREEKCVKLFGVLLDDTHGAATRKRARCEEAAASER PIKMIRIGEPWVSVPSSGPARCGGDN</aaseq>|
| |
| − | DNA = <dnaseqindica>347..613#6494..7135#aagcggaggtccggaggaggaagcggcgagagaagctcagctaggcagggcgacgggcagaaacgcgaccacggcaacaaaccccgccgcgcgcgcccaccgtgccggttacatgggagtagaggcgggcggcggctgcggtgggagggcggtagtcaccggattctacgtctggggctgggagttcctcaccgccctcctgctcttctcggccaccacctcctactagctatacacacccatctcaccataacacacatacatagatagatagatagatagatacatacacacaaacataagtagctaggtagagaaagagatcatagcgttaggtgatcgatcgatggctgctgctgaggcggcggcggcggtggggaagcagcagcagaagggcggcgggggaaggggaggaggcggcggtgggccggcgccgttcctgacgaagacgaaccagatggtggaggagagcgcgacggacgaggtgatctcgtggggaaaggaggggcggtcgttcgtggtgtggaagccggtggagttcgcccgcgacctcctcccgctccacttcaagcactgcaacttctcctccttcgtccgccagctcaacacctacgtacgtacacattacacacactcgatctcttgctccatctcgatactcgatctcctaactttgttgatttgatcatcatatcatcatcctgcactgcatgcgtacgtcgaataattcctgtatctgcgttctgtattcaactgcaggacgccttgaacggcgtccttttgggttagatgacgatgtacttgcagggttgacgtttcttgtctgtgggcgagctttcgctgtcgtggccgagctgtgttcattacgtttccatagttgtctacacgtatgtacgctggtgttttctgacttatatataagggaaatttggaaccatgtcattataattttgcaaaatttgagatatgccatcggtatctcaatgacatgtgggtcaagatggcatatctcaaattttgcaaaattataatggcatggttccaattttccctatatataactcgccttaccaagttgccgtttatagcatttggctatctttttagttcttcttggcgaaatcatatcctactctagcttgcttgtgatatcggttttgttagggaaacaagtaacatgtggttactgaatactccatttgaggctttaagctcaccaaaagcatgagcctacaaggatacggagtaaaggctagctcgtcaatttgttggttcatctatcccgttctagaatctagcagaaactgaaatagccaaatgtgtatgcatgaccacctgttgctagctgcacatgtttctttggtcattgtggggccatggagttagcttgttaagcagttcagaactttccatttgtgccgttcggtcatatatgcccctcaacaaaattaattagctagtgaataattagttgaatgaaacatctggagctagccaaccaattaagctagctgagctaatttgttaggcaaattaatcttgattcgcttctggactgccggaagaggaagaagaagctagctaggcagactccaatcggtctgtacactgtagtcgacctaaagcgtagaaaaggaggtttcttgtcgtgttacacgatcataaactgaatatctgaactgacctttgaggcaaaaatggacaacagggttagatacgtgtgtcagggagtgtgcgccattcggaagtcaattgatctctccacttcgttttagttttccacgcaaagcatgcttatcggttttaaacgacggattcaacctgccttaagaaagataattgggggcagaaagagacaatagaatgatagaaacgattgaaaagagagatgcacctactgctagctgacgtgttcatcatctttttttttccatttctcccttttgacaaaaacctcacgtctgttgtgtagtcaattcgtcagaagttaattccactttactgatgatcttgcatcagaaaacaagaagatcacatagctataaaccacaactctgaaattataaatagcaggtggaaccacaaatctgaaacggcagaggtcatcttcttccattgaaaaaaaaaaggaaaaaaaaagatgaagtgcgatgaagacaaccatgtacgtaagcaagtgtactccattgctgaatgcttcaaagaggaaactctagcatcatgcatatgcatctgagcatctcgaagatgaccatttccaattactattagctagctcgttgtgaaagggcatatagtctagtggttgcggtgacctaaatagcaccctaaggtattgagttcaaatctctataggagtgaatttcagattgggttatttgagggctagcaccccaaagttctgagttcaaatctcgatagtagcgaatttcagattgggttatttgagggctagcacaccaaggttctgagttcaaatctccatagaagcgaatttcagattagattatttgaggactaggtttctatatttgataggctaagttcctaattaaaaatatatttgataggctaagtttctaattaaaaagaggctgtatatatctggttgaatatagagggctggtaaaaaaatacctcgtctactagaagggtgttcatatctgaactggcaaaaggaaaggacacgtcgcgactagcaaattgcgacgggagcaaagtagcaaacagttccatgaaagcaaagttaattaggtaactgatatatagtagcttgcagatcaggcataattcaggccggccgtcgattgacacgccaagtgtactagtggcgacaaagcatgatttctggtgcatctctatgattatatacgggacaggaatcttggtggaaatttctgggatggattgacttttccgggctcttcgtctatgatcgtctagaaatgttggcacttgttgtaccgtactcaacctgcacatgcaaagcatccagcgcagctaatctttgtttgcctttactcgtgttcgtgcttaatttgtggggtagaaagtttcttcagcgaacatgtcgtgtgtggtttctcctgtgcttgatcacaacatcacaggatcttggacctttggtgcatgaatactgacatgcatgttcatcagtactatagttatagttgtcaaagcgtcacgctaataacaacaagctatttatatcttcaaaagaaaaaaaaaacaagatcagctatctagctcagttctcagtactggttcttcaattgctgcaactggagtagatgagaatactccaaagtgtgaacgtctaatagtattgattagcagcgacgtctgacagagatgtataacaagtatcctgacgtctggtatattgaattcaatggaacagttgagttactctttccgttgtgattgattctgcacatcttgtggtgttgttcgaatttgacttctagtagaaatttgatcttaggatctgtcagtgagacagtgatatatccatcatgttttttttagatgacatccttcttgttttagcacccaacattcatgatatttgcttccctttgatatactgttcttcaagcgttaatccttgaatatactccctccgtttcatattataaatcgtttaacttttttctaatcaaactttattaagtttgacctagtttatagaaaaatttgatagtattatcagcacaaaacaaatatattatcaaaatatattcaagatttaatgagtattaagatggttttttgttccgatcaaacatttaatttagtttagtaagtcagatgcatggaaactacaaatataactaattggaaaaaacaaaaatataaaataagtctaacgcttttggatggagagagtagataatataaatgctgcagaatgactgcagagagtggaagttgtcacctatggcctcgtttagacgggccttaaatctgtccatctacgtatatggccgagtgtttgaactaaactagttgggtggcccgcgcaattgcgcagctagtatccatacaaaattatcttcttttatatatgattttacttaaaatttgttaaataactatctcgttgtcttaggactttaaaagaccgaaccttaaaatctccatgtttctaattttgtagttttaaaaagtcacaccactcactacctcttacctctttgtcaccccctttatttgtttgcttatctactacagcttctatttatcctccttggaactttaaaattgaaccttataaattttagagttaattaaatcgttggttttcattttttaattctcgtcaaatgccgctactctactcctctacggcccgtccaccgcttcctctctttattgttattgagattttaacaatcgaacacaattatcgccagtgttcatttttaactttctaaaagtcccgccaaactgtcagcagcattgccattatactcttgtacggcccgtcctatgcctttccttttaattatcattgagattttaaaaattgaacgtgattatcattgtggtttatttttttactttctagaagtcccgccgatcactctgattgtgcttcttaacgggttgcccgccatctctcctcttaatcgccattggaattttatttggggttttgtttatactttttacgcccattgccttccctcttttttattattgagattttacaaatcaaatatgattttcattggagtttattttttactttctagaagtcccaccaacccccgtgatcatgctattacaatggcctgtccattgtccctcgtcttaattgtcattggattctattttaggttttgtttatagtttttagatgtcccatcaaccactgccaccctactcctttacagtctcgttgcttctccgctctttattttcatttgccatcgttgtgtttttagatggattgtgttttatttccatattttttattcagatattatgttgtttataaattttattcctacttgaacgcctttaattgtttttaaatttttagaatttaatttattttttattccaaaatttaattaaactcgtgctctagatgatctcttctttcagtattgcttattttttattccgaattttagttattttaaattgtatgcccatatgaactcttatttttattttctaactttagaatttagtttggtgatgggttgctctttcaatattcctttttgttaatttcgaatttgagttatttctaaattgtaatcctacttataatatctttttttgtaatttcagaatttattttattttatttttcattccaacatttaattaatcttgtgttgtgttttgaatggcctattctttcaatatcctaacttattattccaaattgataattctaggcttatagagttctgaactgcatgttttcaaagtatggttcatggatggattgttgatttggttaggacatggtatttcttagtactctcagttttttttaactaaccaatatcatataaaaaaatataggagtatttttttataaaaatattgacatatataggctttctagcatttatgattagaaacttgagaggaaagagaacccatctatatatgtgtatttgaaaattagcatgtggtagtcaataaaaacttattgtaattatattagagaataggattactgctaaaagttttagcttttcatttgaatccgatggaggacttgtcctgtcctgtttttcctgtcctgttgctagaccttcatagctatgattccaaaaaaaacgtgtcatgttgttgtgtggctttgctcggttgggagtccgactgcaaacatgactatgagaaggacatgtatactgcgtagtattttttttctttatttatatacctatacaatcaatcttaaccgttataatatagatccactatgagaatatatttttctttttatttcaaattttaattaatctcgtattggatttatagatggactcttattttaattttacttatttttaattccgaatttcaattattcttagattgtacttctatttggactcttcttttctttttcttcgattaacgtggtaatttctaggcctctacggtgaacgtggtgcctctttttcgaactgttttaataatataatagataggtagatagatagattcttggcccacagatatagatgggccggattaaactgttttgcacgtagttgtctatgaacaaagaatatcccaaatctaagcatttatgccaaattttcattgttgattgtacatttgtacttgtgcattcaccgaattaacgatgtgtgataacaaacacgttcttagtgtctttctgccaaaaacatgtccttattgtcttgtgttgattaggacagaaacatgttacgattgcccctcaatacgttcacacgatctgaccggggctaacgagagatggcgactattcatgcagggtttccggaaggtggtgcccgatcggtgggagttcgccaacggcaacttccggcgaggagagcaaggcctcctctccggcatccgccgccgcaaggcgacgacgcctcagtcctccaaatcctgcggcagcggcgtcaacgtcgcgttccctccgccgctgccccctctgcccccggagccgtcggcgaccacgtccagcggcaacgaccgcagctcctcctccgcgtcctcgccgccgcgggcggacatcaccagcgagaacgagcagctcaggaaggacaaccaaacgctgacgatggagctggcgcgggctcggcggcactgcgaggagcttctgggcttcctgtcgcgcttcctcgacgtccggcagctcgatctccggctgctcatgcaggaagacatgcgagcggcggccggcggcgtcggcggcgagcagcgcgtgcaagagcacgcccgggaggagaagtgcgtgaagctgttcggcgtgctcctcgacgacacccatggcgccgccacgaggaagagggcgcggtgcgaggaggcggctgccagcgagcggccgatcaagatgatcaggatcggcgagccgtgggtcagcgttccatcgtcggggccggcgcggtgtggcggcgacaactgaagtccaaacttgtgcatgccacggccatgacctgatcgaccaggcgaacggcaagcagaaggcatgcatggtgaggttggtggcaagaatggtccgatcaaccaagtcattaggtaaaacgagacgaattaagcacgccaaatacgtgcggccctgtgttaatcacgggttgctaccatgctagtagtaaggtaggaacagtacgaggagtcaaggctgaccgaagcgaagcagccggctcttgtgtctggacgttgtttcagttaacactgaaagcttcaccttactatggattatacattttttagat</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069899.1 RefSeq:Os09g0456800]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Please input one-sentence summary here.
Annotated Information
Function
Heat stress transcription factors (Hsfs) are the central regulators of defense response to heat stress. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to
their protein structures[1]. HsfB1 is one gene of the HsfB which consists of 8 genes. plant Hsfs diversify in their biological functions[2][3]. HsfA members are capable of transcriptional activation, while HsfB members act as repressors or as co-activators (e.g., HsfB1) of HsfA members. Overexpression of Hsf genes in transgenic plants resulted in an up-regulation of heat stress-associated genes and an enhancement of thermotolerance, whereas the down-regulation of Hsf genes leads to a reduction in the thermotolerance[4][5]. In addition to control of heat stress response, Hsfs have also been reported to be involved in the defense response to pathogen attack, oxidative stress, heavy metals, dehydration and salinity, and in certain processes of development and differentiation[6].
Expression
Chuang wang[7] detect the expression patterns of OsHsfs in rice. They find the majority of OsHsf genes have a low to moderate level in most tissues, while some display a tissue-specific manner (Fig.1). For example HsfB1, than other genes has a relative heavy level in the tissues of root and seed. Chuang wang also studys the Cis-acting elements in OsHsf promoters. They find 9 different Cis-acting elements in total. One of the Cis-acting element,ARE and GC-motif involved in the anaerobic induction, has a high number of 4 in the HsfB1. We can suppose that the high level of HsfB1 in seed and root and the high level of ARE and GC-motif are adaptive to the environment for rice.
Evolution
You can also add sub-section(s) at will.
Chuang wang[7] construct neighbor-joining phylogenetic trees(fig.2) to determine the phylogenetic relationship among the OsHsfs. AtHsf stand for Arabidopsis Hsf, which is used to classify rice Hsfs.
Labs working on this gene
Here some labs studing the OsHsfs, not the only OsHsfB1,are provided:
1 State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science,Zhejiang University, Hangzhou 310058, China.
2 Department of Molecular Cell Biology, Biocenter of the Goethe University, Germany.
3 Microbiology and Cell Science Department, Program of Plant Molecular and Cellular Biology, University of Florida, Bldg. 981, Gainesville.
References
1 Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A., Scharf, K.D., 2001. Arabidopsisand the heat stress tran scription factor world: how many heat stress transcription factors do we need? Cell Stress Chaperones, 6(3): 177-189.
2 Kotak, S., Larkindale, J., Lee, U., von Koskull-Döring, P., Vierling, E., Scharf, K.D., 2007a. Complexity of the heat stress response in plants. Curr. Opin. Plant Biol., 10(3): 310-316.
3 von Koskull-Döring, P., Scharf, K.D., Nover, L., 2007. The diversity of plant heat stress transcription factors. Trends Plant Sci., 12(10):452-457.
4 Charng, Y.Y., Liu, H.C., Liu, N.Y., Chi, W.T., Wang, C.N., Chang, S.H., Wang, T.T., 2007. A heat-inducible transcription factor, HsfA2, is required for extension of acquired thermotolerance in Arabidopsis. Plant Physiol., 143(1):251-262.
5 Mishra, S.K., Tripp, J., Winkelhaus, S., Tschiersch, B., Theres, K., Nover, L., Scharf, K.D., 2002. In the complex family of heat stress transcription factors, HsfA1 has a unique role as master regulator of thermotolerance in tomato. Genes Dev., 16(12):1555-1567.
6 Larkindale, J., Hall, J.D., Knight, M.R., Vierling, E., 2005. Heat stress phenotypes of Arabidopsis mutants implicate multiple signaling pathways in the acquisition of thermotolerance. Plant Physiol., 138(2):882-897.
7 Chuang WANG, Qian ZHANG, Hui-xia SHOU. Identification and expression analysis of OsHsfs in rice. Journal of Zhejiang University SCIENCE B 2009 10(4):291-300.
Structured Information