Difference between revisions of "Os06g0254700"

From RiceWiki
Jump to: navigation, search
 
(3 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
 
 
Os06g0254700 encode a caleosin
 
Os06g0254700 encode a caleosin
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
 
 
Os06g0254700 is a stress responsive gene. It encodes the caleosin which mainly lay in oil body or lipid body.These physiological and biochemical processes including regulation of genes involvedin stomatal closure, maintaining internal and external balance of water and ions,adjusting the synthesis and catabolism.Caleosins not only promote formation of oil body but also is related to drought stress.
 
Os06g0254700 is a stress responsive gene. It encodes the caleosin which mainly lay in oil body or lipid body.These physiological and biochemical processes including regulation of genes involvedin stomatal closure, maintaining internal and external balance of water and ions,adjusting the synthesis and catabolism.Caleosins not only promote formation of oil body but also is related to drought stress.
 
===Expression===
 
===Expression===
Please input expression information here.
 
 
It is located on chromosome 6.There are two other caleosin genes-Os06g0254300 and Os06g0254600 in chromosome 6.These three genes get together because tandem duplication.Caleosins have a significant feature that EF-hand domain in N-terminal can combine Ca2+,a central hydrophobic region and a security protein kinase phosphorylation sites in C-terminal.Caleosins's N-terminal and C-terminal are located in the cytoplasm,however central hydrophobic region are anchored in the phospholipid monolayer membrane.
 
It is located on chromosome 6.There are two other caleosin genes-Os06g0254300 and Os06g0254600 in chromosome 6.These three genes get together because tandem duplication.Caleosins have a significant feature that EF-hand domain in N-terminal can combine Ca2+,a central hydrophobic region and a security protein kinase phosphorylation sites in C-terminal.Caleosins's N-terminal and C-terminal are located in the cytoplasm,however central hydrophobic region are anchored in the phospholipid monolayer membrane.
 
===Evolution===
 
===Evolution===
Please input evolution information here.
 
 
Six caleosin genes in rice distribute on four different chromosomes.Os06g0254300,Os06g0254600, OsCLO-6 three genes are located to adjacent position of chromosome 6.Homology of Os06g0254300 and Os06g0254600reach to 92%,Os06g0254600 and Os06g0254700 is 49%.Indicating that Os06g0254300 and Os06g0254600 originated in a close repeated events, but Os06g0254700 and Os06g0254600 repeated earlier.Excavations and research in arid pathway for in-depth understand the mechanisms of plant drought, reducing the effects of drought, etc,are great significance Os06g0254700 contains introns,it is described Os06g0254700 is not originated in retrotransposition events.
 
Six caleosin genes in rice distribute on four different chromosomes.Os06g0254300,Os06g0254600, OsCLO-6 three genes are located to adjacent position of chromosome 6.Homology of Os06g0254300 and Os06g0254600reach to 92%,Os06g0254600 and Os06g0254700 is 49%.Indicating that Os06g0254300 and Os06g0254600 originated in a close repeated events, but Os06g0254700 and Os06g0254600 repeated earlier.Excavations and research in arid pathway for in-depth understand the mechanisms of plant drought, reducing the effects of drought, etc,are great significance Os06g0254700 contains introns,it is described Os06g0254700 is not originated in retrotransposition events.
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
Line 17: Line 13:
  
 
==References==
 
==References==
Please input cited references here.
 
 
1  Muhammad F, Abdul W, Dong J L, et al. Advances in drought resistance of rice. Crit Rev Plant Sci, 2009, 28: 199–217  
 
1  Muhammad F, Abdul W, Dong J L, et al. Advances in drought resistance of rice. Crit Rev Plant Sci, 2009, 28: 199–217  
 
2  Zhang J H, Jia W S, Yang J C, etal. Role of ABA in integrating plant responses to drought and salt stresses. Field Crop Res, 2006, 97:  
 
2  Zhang J H, Jia W S, Yang J C, etal. Role of ABA in integrating plant responses to drought and salt stresses. Field Crop Res, 2006, 97:  
Line 29: Line 24:
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
 
GeneName = Os06g0254700|
 
Description = Caleosin related family protein|
 
Version = NM_001063839.1 GI:115467409 GeneID:4340665|
 
Length = 2956 bp|
 
Definition = Oryza sativa Japonica Group Os06g0254700, complete gene.|
 
Source = Oryza sativa Japonica Group
 
  
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:8010880..8013835|
 
CDS = 8011087..8011234,8011335..8011460,8012161..8012258,8013057..8013142,8013279..8013434<br>,8013594..8013627|
 
GCID = <gbrowseImage1>
 
name=NC_008399:8010880..8013835
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:8010880..8013835
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcctccaaacccgcggacgttacggctacaggtggcggcggcgtcgccgtcgtccgtgacaacaacaacaacgccggcggcggcgaggcggaggtgtaccgctccgagctgacgccgctgcagaagcacgtcgccttcttcgaccgcaacaaggacggcatcatctacccctccgagacctaccaagggttccgcgcaatcggggcaggagtcgtgctgtccgccgtcggcgccgtgttcatcaatggcggacttgggcccaagacgataccggagaacaccaagactggtctcaagttacccatatacgtcaagaacatccacaaaggcaagcatggaagcgattcaggcgtgtatgatgcgaatggaaggtttgtcccagaaaagttcgaggaaatattcaagaagcatgctcacaccaggcctgatgccctaacagacaaagagctgaaggagttgctccaatcaaacagggagcctaaagatttcaaaggatggttgggtggcttcacagagtggaaagtattgtactacctctgcaaagacaaggatggatttcttcacaaggatactgtcagggcagtctatgatggaagcctatttgcaaagatggagcaagagaagcagtctgctaagaagaaatga</cdnaseq>|
 
AA = <aaseq>MASKPADVTATGGGGVAVVRDNNNNAGGGEAEVYRSELTPLQKH                    VAFFDRNKDGIIYPSETYQGFRAIGAGVVLSAVGAVFINGGLGPKTIPENTKTGLKLP                    IYVKNIHKGKHGSDSGVYDANGRFVPEKFEEIFKKHAHTRPDALTDKELKELLQSNRE                    PKDFKGWLGGFTEWKVLYYLCKDKDGFLHKDTVRAVYDGSLFAKMEQEKQSAKKK</aaseq>|
 
DNA = <dnaseqindica>2602..2749#2376..2501#1578..1675#694..779#402..557#209..242#agcgaggcatccaccaccatcagccaaagtgccaaacgatcgatcgatctctgcagtctgcagattagcccaccacctccagcatcgggtccacgaatgcacaccctgtcaactccactccacccgcttttctttccctctccccgccaccttcacatctcaacctttcctctccctctctctctctctctctgatctcgtcgttcccatggcctccaaacccgcggacgttacggctacaggtgagccatctatctacatacacacgtcctcgtagtaacgcgccatggctgctgcttcttcttcttcttcttcgtctgcttattatggcggcgcgaataaatctgtcgcgttccttgtcgccaccgtcgtcaccgtgcctctgtgtgccctgctgctaggtggcggcggcgtcgccgtcgtccgtgacaacaacaacaacgccggcggcggcgaggcggaggtgtaccgctccgagctgacgccgctgcagaagcacgtcgccttcttcgaccgcaacaaggacggcatcatctacccctccgagacctaccaaggtttcagctcacgcagccaccaccaccgatcgatcccctttcctcttcactgttcacacagcgattattttcttcatgatttttttctttttctcaagcgttcgattcgttcgttcgttgctgcgcttgcttgcagggttccgcgcaatcggggcaggagtcgtgctgtccgccgtcggcgccgtgttcatcaatggcggacttgggcccaagacgataccggtcagtacaacagctgcagacatcaaatctccctctctgtctcaattcaatgttactgttttcttgcatactgccaaagtgccaacgctttgctttgctcgctctgcgccaaaacatgaactgtctttttttttttttgtctagttgttgcaagctactatctgggtatgcacaggtgtttcttagttcaatttcacagtttgggtactgtttcttcgttcagttcatcgacaatatttcagtagatgagcacaacaaactaatatctcctgccactaattttccatttctgttgcacaagccataggcccgtagctaagcgcgtctcatggttaagaaaaagaagatacaatttcttttacaatatttattcagatcggtgttaaaagtatcaaacgattaggaaactactaaacgagaaacgtattcgtaacgtggaatatataccaatgccagcacctacattgcaagggaaagatacctcctttaattcggaaaaagaaagagaaagcactgatgaagcaccactgcactgataagataactgaaaagaaagagaacaccaatgggccacgcattattgcataatatcgatagacacggacaatacaactgcattttcttgtgtgtactggacagagtaaagtctcaggctcagctcacttttctgttgcctctttaatcttttcaaattgactttgaaacagagacacgaaatggggattgatttagttgcacgaactatttactgatgctgactctcgtttaccatttttcaacctcactgctttactgtaggagaacaccaagactggtctcaagttacccatatacgtcaagaacatccacaaaggcaagcatggaagcgattcaggcgtgtatgatgcgaatggaaggtacctttctatattattatgtttttaagctgaaggtaccttaatttctttatgtgtcagcatcagtatgaacatgactcatgcggccagcacagatgtcagatgtttaattgggcttaatcgctttgtcgttgtactttactcatcaagattaggataaattaagccagcacctaaccataaagtaacacagacgcggatgaattgcttaacaaacaggagaactgaatcgcctttttcatgtggcatggtgatgcagagatttgagggatatcacccggccaaaaagatttgagagatatctgtttattaggcactttagttgtctgttccttctgtcaaaagctagtgaagatgcatccaaactatagttctaagagagatcacgcataatatgaaatcaaagatatggttgtttcattttctttagaacacttggttgttccattgcatgcatagtttaatacgtgtgaaatgcacatggtgaaaaaaatattgccactaagactcatggtatcacattgagatctataagcttttaggatcactatgcagtgaggctatcactgctgttgttttcttattgtttttgtttcaatgcgaacaaacaaaggcacttgtcttagctagagtcgtaaaaataatgcaatagggtaacatggatctagatttgctaaccacacaatatgtacacttgcaggtttgtcccagaaaagttcgaggaaatattcaagaagcatgctcacaccaggcctgatgccctaacagacaaagagctgaaggagttgctccaatcaaacagggagcctaaagatttcaaaggatggtgagttctcatctagattaagactgtaagaacaatggtaaaatgaagttatgttttgtccatgctcatccttttttttctttgggggaaaacgttgcaggttgggtggcttcacagagtggaaagtattgtactacctctgcaaagacaaggatggatttcttcacaaggatactgtcagggcagtctatgatggaagcctatttgcaaagatggagcaagagaagcagtctgctaagaagaaatgataagaccatactgggtgctgtaattatctgttattgttgcaggtgattgtaaattacggtgtgggtgtgaatccaaaattattgctgtagtttgattgcgcgtgtttgttgacccgttcctgtaacaagaagctatttgtgaagttattggaagtgtttgtaaacatggtggtatcctctgatttattcacttcatttttttctttt</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063839.1 RefSeq:Os06g0254700]|
 
}}
 
 
[[Category:Genes]]
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Japonica mRNA]]

Latest revision as of 01:40, 30 June 2016

Os06g0254700 encode a caleosin

Annotated Information

Function

Os06g0254700 is a stress responsive gene. It encodes the caleosin which mainly lay in oil body or lipid body.These physiological and biochemical processes including regulation of genes involvedin stomatal closure, maintaining internal and external balance of water and ions,adjusting the synthesis and catabolism.Caleosins not only promote formation of oil body but also is related to drought stress.

Expression

It is located on chromosome 6.There are two other caleosin genes-Os06g0254300 and Os06g0254600 in chromosome 6.These three genes get together because tandem duplication.Caleosins have a significant feature that EF-hand domain in N-terminal can combine Ca2+,a central hydrophobic region and a security protein kinase phosphorylation sites in C-terminal.Caleosins's N-terminal and C-terminal are located in the cytoplasm,however central hydrophobic region are anchored in the phospholipid monolayer membrane.

Evolution

Six caleosin genes in rice distribute on four different chromosomes.Os06g0254300,Os06g0254600, OsCLO-6 three genes are located to adjacent position of chromosome 6.Homology of Os06g0254300 and Os06g0254600reach to 92%,Os06g0254600 and Os06g0254700 is 49%.Indicating that Os06g0254300 and Os06g0254600 originated in a close repeated events, but Os06g0254700 and Os06g0254600 repeated earlier.Excavations and research in arid pathway for in-depth understand the mechanisms of plant drought, reducing the effects of drought, etc,are great significance Os06g0254700 contains introns,it is described Os06g0254700 is not originated in retrotransposition events. You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1 Muhammad F, Abdul W, Dong J L, et al. Advances in drought resistance of rice. Crit Rev Plant Sci, 2009, 28: 199–217 2 Zhang J H, Jia W S, Yang J C, etal. Role of ABA in integrating plant responses to drought and salt stresses. Field Crop Res, 2006, 97: 111–119 3 Kant P, Gordon M, Kant S, et al. Functional genomics-based identification of genes that regulate Arabidopsisresponses to multiple abiotic stresses. Plant Cell Environ, 2008, 31: 697–714 4 Oono Y, Seki M, Nanjo T, et al. Monitoring expression profiles of Arabidopsis thalianagene expression during rehydration press after dehydration using ca. 7000 full-length cDNA microarray. Plant J, 2003, 34: 868–887 5 Kreps J A, Wu Y J, Chang H S, et al. Transcriptome changes for Arabidopsis in response to salt, osmotic and cold stress. Plant Physiol, 2002, 130: 2129–2141

Structured Information