Difference between revisions of "Os06g0683400"

From RiceWiki
Jump to: navigation, search
(Knowledge Extension)
 
(12 intermediate revisions by 3 users not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice Os06g0683400 was reported as '''''OsCCD1''''' <ref name="ref1"/> in 2016 by researchers from Chinese Academy of Sciences. '''''OsCCD1''''' is a small Ca2+-binding protein with one EF-hand motif in rice. This protein was asmall protein with M.W. 13.9 kDa, pI 5.08.
 +
==Annotated Information==
  
==Annotated Information==
 
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsCCD1''''' is a small calcium-binding protein with one EF-handmotif.
 +
* '''''OsCCD1''''' gene enhanced the responsiveness of rice seedlings toexogenous ABA application, and conferred the tolerances of riceseedlings to osmotic and salt stress<ref name="ref1" />.
 +
* Semi-quantitative RT-PCR analysis revealed that '''''OsDREB2B''''', '''''OsAPX1''''' and '''''OsP5CS''''' genes are involved in the rice tolerance to osmotic and salt stresses. In sum, '''''OsCCD1''''' gene probably affects the '''''DREB2B''''' and its downstream genes to positively regulate osmotic and salt tolerance in rice seedlings<ref name="ref1" />.
  
===Expression===
+
===Mutation===
Please input expression information here.
+
[[File:OsCCD1-2.png|right|thumb|327px|'''Figure 6.''' ''Fig. 6. Osmotic tolerance in rice seedlings hydroponically cultured and treated with 20% PEG-6000 for 7 days followed by recovery for 7 days.<ref name="ref1" />.'']]
 +
* To identify the functions of '''''OsCCD1''''' gene in the osmoticand salt tolerance, scientists generated three homozygous '''''OsCCD1'''''-overexpressing transgenic rice lines (OD1-1, OD1-2 and OD1-3) in the ZH11 background, and identified twohomozygous T-DNA mutant lines (TD1-1 and TD1-2) in the HY background<ref name="ref1" />.
 +
* To detect the tolerance of rice seedlings to osmotic stress,'''''OsCCD1'''''-overexpressing lines, DNA mutant lines and their respec-tive wild type plants, were hydroponically cultured in the 1/4 MSliquid medium to 10 days, followed by the osmotic stress treatment with 20% PEG-6000 for 7 days and then recovery for 7 days. After the osmotic stress treatments, '''''OsCCD1'''''-overexpressing lines showed the significantly higher survival rates (84.6%, 83.2%, and 82.3%)than the wild type ZH11 (77.0%) (p < 0.05), the T-DNA mutant lines showed the significantly lower survival rates (57.8% and 58.3%)than the wild type HY (93.1%) (p < 0.01) (Figure 1).
 +
* In addition,'''''OsCCD1'''''-overexpressing lines had significantly higher Proline (Pro),soluble sugar contents and significantly lower MDA contents in theshoots of rice seedlings than the wild type ZH11 (p < 0.05). However, T-DNA mutant lines had significantly lower levels of solublesugars and Pro but significantly higher MDA contents in the shootsof rice seedlings than the wild type HY (p < 0.05, p < 0.01) (Figure 1), Before the osmotic stress treatment, the chlorophyll contents ofthe shoot tissues did not show significant difference between thethree overexpressing transgenic lines and the wild type ZH11 orbetween two T-DNA insertional mutant lines and the wild type HY. However, osmotic stress treatments decreased the chlorophyll con-tents of all these rice lines. There were significant differences in thechlorophyll contents between the overexpressing lines or T-DNAinsertional mutant lines and their respective wild types (p < 0.01)(Figure 1), suggesting that '''''OsCCD1''''' genes enhanced the osmotic stresstolerance of rice seedlings and the physiological metabolism<ref name="ref1" />.
 +
[[File:OsCCD1-3.png|right|thumb|327px|'''Figure 7.''' Salt tolerance in rice seedlings hydroponically cultured and treated with 150 mM NaCl for 3 days followed by recovery for 7 days. <ref name="ref1" />.'']]
 +
* When the ten-day-old rice seedlings were treated with 150 mM NaCl for 3 days followed by recovery for 7 days, '''''OsCCD1'''''-overexpressing lines showed significantly higher survival rates(77.4%, 78.2% and 81.1%) than the wild type ZH11 (62.3%) (p < 0.05),the T-DNA mutant lines showed significantly lower survival rates(44.2% and 45.5%) than the wild type HY (64.9%) (p < 0.01) (Figure 2). In addition, '''''OsCCD1'''''-overexpressing lines had significantlybeen higher soluble in sugar and Proline (Pro) contents and signif-icantly higher MDA contents in the shoots of rice seedlings thanthe wild type ZH11 (p < 0.01). However, T-DNA mutant lines hadextravagantly lower contents of soluble sugars and Pro but sig-nificantly higher contents of MDA in the shoots of rice seedlingsthan the wild type HY (p < 0.05, p < 0.01) (Figure 2). Before the saltstress treatments, the chlorophyll contents of the shoot tissues didnot show significant difference between the three overexpressingtransgenic lines and the wild type ZH11 or between two T-DNAinsertional mutant lines and the wild type HY. However, comparedwith their respective wild type rice lines, chlorophyll contentsshowed significant difference between the overexpressing linesor T-DNA insertional mutant lines and their respective wild types(p < 0.05, p < 0.01) (Figure 2), suggesting that '''''OsCCD1''''' genes enhancedthe salt stress tolerance of rice seedlings and the physiological metabolism<ref name="ref1" />.
  
===Evolution===
+
===Expression Pattern===
Please input evolution information here.
+
* '''''OsCCD1''''' gene was induced by osmotic and salt stress viacalcium-mediated ABA signal, and Ca2+ played as a mediatorin the transduction of the ABA signal in rice seedlings<ref name="ref1" />.
  
You can also add sub-section(s) at will.
+
===Subcellular localization===
 +
* Transient expression ofgreen fluorescent protein (GFP)-tagged '''''OsCCD1''''' in rice protoplasts showed that '''''OsCCD1''''' was localized inthe nucleus and cytosol of rice cells in the rice seedlings(Figure 3)<ref name="ref1" />.
 +
===Homologues===
 +
* Phylogenetic and EF-hand motif analysis showed that, basedon the degree of amino acid sequence similarity of different plantspecies, the CCD1 homologues in plants can be categorized intothree groups (Groups I, II and III), containing nine, four and onemembers, respectively. Six homologous CCD1 proteins from mono-cot cereal crops clustered together in the Group I. In addition, '''''OsCCD1''''' manifested the highest sequence identity with '''''TaCCD1''''' and '''''BdPBP1''''', and the conserved one-EF-hand; Group II consisted of genesequences from dicot species, and the Arabidopsis '''''AtKIC''''' was clas-sified as Group III (Figs. S1 and S2). Notably, all of these 14 proteinspossessed one EF-hand domain with the conserved Ca2+-binding loop DxDGDGALxxx, implying that they are conservedin the calcium signal transduction in the plant growth and stressresponses<ref name="ref1" />.
 +
 
 +
===Knowledge Extension===
 +
* Calcium ion, Ca2+, is adopted as a macroelement in the growthand development process, and a ubiquitous secondary messengerinvolved in the signal transduction of the development and stressresponse in plants. These Ca2+ signaturesare decoded by several types of Ca2+ sensor proteins that contain a high-affinity Ca2+-binding helix-loop-helix structure, known as the EF-hand motif<ref name="ref2" />. The binding of Ca2+-binding proteins(CaBPs) triggered a change in conformation and enzymatic activ-ity, followed by the participation of these activated Ca2+/Ca2+ sensor complexes in the induction of appropriate physiological responses, including ion transport, metabolism, post-translational protein modifications and gene expressions.
 +
* Based on the Ca2+-binding affinities and mode of actions, CaBPs can be classified into two groups: (1)Ca2+ sensors, translate thesignal to various responses; (2) Ca2+ buffers, control the level offree Ca2+ ions in the cytoplasm.<br><br>
 +
[[File:OsCCD1-4.png|center|thumb|700px|'''Figure 3.''' ''Subcellular localizations of OsCCD1-GFP fusion protein in the rice mesophyll protoplasts and epidermal protoplasts.<ref name="ref1" />.'']]
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* MOA Key Laboratory of Crop Ecophysiology and Farming System in the Middle Reaches of the Yangtze River
 +
* College of Plant Science and Technology
 +
* Huazhong Agricultural University, Wuhan 430070, PR China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 
+
* <ref name="ref1">
 +
Jing P, Zou J, Kong L, Hu S, Wang B, Yang J, Xie G. OsCCD1, a novel small calcium-binding protein with one EF-hand motif, positively regulates osmotic and salt tolerance in rice. Plant Sci. 2016 Jun;247:104-14. doi: 10.1016/j.plantsci.2016.03.011. Epub 2016 Mar 24. PubMed PMID: 27095404.
 +
</ref>
 +
* <ref name="ref2">
 +
I.S. Day, V.S. Reddy, G. Shad Ali, A.S. Reddy, Analysis of EF-hand-containingproteins in arabidopsis, Genome Biol. 3 (2002), RESEARCH0056.
 +
</ref>
 +
</references>
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 6]]
GeneName = Os06g0683400|
 
Description = Similar to EF-hand Ca2+-binding protein CCD1|
 
Version = NM_001064924.1 GI:115469579 GeneID:4341871|
 
Length = 677 bp|
 
Definition = Oryza sativa Japonica Group Os06g0683400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
 
AP = Chromosome 6:29360814..29361490|
 
CDS = 29360903..29361280|
 
GCID = <gbrowseImage1>
 
name=NC_008399:29360814..29361490
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008399:29360814..29361490
 
source=RiceChromosome06
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcggcggagcagagacagcagcagcagatgatgcaggaggggttcgaggactacctgccggtgatggcggagaggctgggggaggaagggctgatgcaggagctcgcaagcgggttccgcctgctcatggacccggcctccgggctcatcaccttcgacagcctccgccgcaacgcgccgctgctcggcctcggcgggatgtccgacgacgacctccgggggatgctcgccgagggcgacttcgacggcgacggcgccctcagcgagatggagttctgcgtcctcatggtcaggctcagccccgacctcatggacgagcctcgccggtggctcgacgacgccgtcgcccaggcctcacagttcctctttcattag</cdnaseq>|
 
AA = <aaseq>MAAEQRQQQQMMQEGFEDYLPVMAERLGEEGLMQELASGFRLLM                    DPASGLITFDSLRRNAPLLGLGGMSDDDLRGMLAEGDFDGDGALSEMEFCVLMVRLSP                    DLMDEPRRWLDDAVAQASQFLFH</aaseq>|
 
DNA = <dnaseqindica>90..467#atccctctcctcttctcctcctctcaaagatcgcaagaagcaaacaagaacacaacaaatcgatcgatcagtcaacctcactcattctcatggcggcggagcagagacagcagcagcagatgatgcaggaggggttcgaggactacctgccggtgatggcggagaggctgggggaggaagggctgatgcaggagctcgcaagcgggttccgcctgctcatggacccggcctccgggctcatcaccttcgacagcctccgccgcaacgcgccgctgctcggcctcggcgggatgtccgacgacgacctccgggggatgctcgccgagggcgacttcgacggcgacggcgccctcagcgagatggagttctgcgtcctcatggtcaggctcagccccgacctcatggacgagcctcgccggtggctcgacgacgccgtcgcccaggcctcacagttcctctttcattagaaagttcgacatggataggattcttcttctttttttctttctttcttctttcttctcgttgttcatagcatcaggattcatcaagggcactgctcattggttcgcggattccaatcgcatttgtactctcatgtactacactctgcttgtttcttcgttccaagtggaaactggaatctgaattaattgatcagcaagcttcttcgtttc</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064924.1 RefSeq:Os06g0683400]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 6]]
 
[[Category:Chromosome 6]]
 

Latest revision as of 07:52, 1 July 2016

The rice Os06g0683400 was reported as OsCCD1 [1] in 2016 by researchers from Chinese Academy of Sciences. OsCCD1 is a small Ca2+-binding protein with one EF-hand motif in rice. This protein was asmall protein with M.W. 13.9 kDa, pI 5.08.

Annotated Information

Function

  • OsCCD1 is a small calcium-binding protein with one EF-handmotif.
  • OsCCD1 gene enhanced the responsiveness of rice seedlings toexogenous ABA application, and conferred the tolerances of riceseedlings to osmotic and salt stress[1].
  • Semi-quantitative RT-PCR analysis revealed that OsDREB2B, OsAPX1 and OsP5CS genes are involved in the rice tolerance to osmotic and salt stresses. In sum, OsCCD1 gene probably affects the DREB2B and its downstream genes to positively regulate osmotic and salt tolerance in rice seedlings[1].

Mutation

Figure 6. Fig. 6. Osmotic tolerance in rice seedlings hydroponically cultured and treated with 20% PEG-6000 for 7 days followed by recovery for 7 days.[1].
  • To identify the functions of OsCCD1 gene in the osmoticand salt tolerance, scientists generated three homozygous OsCCD1-overexpressing transgenic rice lines (OD1-1, OD1-2 and OD1-3) in the ZH11 background, and identified twohomozygous T-DNA mutant lines (TD1-1 and TD1-2) in the HY background[1].
  • To detect the tolerance of rice seedlings to osmotic stress,OsCCD1-overexpressing lines, DNA mutant lines and their respec-tive wild type plants, were hydroponically cultured in the 1/4 MSliquid medium to 10 days, followed by the osmotic stress treatment with 20% PEG-6000 for 7 days and then recovery for 7 days. After the osmotic stress treatments, OsCCD1-overexpressing lines showed the significantly higher survival rates (84.6%, 83.2%, and 82.3%)than the wild type ZH11 (77.0%) (p < 0.05), the T-DNA mutant lines showed the significantly lower survival rates (57.8% and 58.3%)than the wild type HY (93.1%) (p < 0.01) (Figure 1).
  • In addition,OsCCD1-overexpressing lines had significantly higher Proline (Pro),soluble sugar contents and significantly lower MDA contents in theshoots of rice seedlings than the wild type ZH11 (p < 0.05). However, T-DNA mutant lines had significantly lower levels of solublesugars and Pro but significantly higher MDA contents in the shootsof rice seedlings than the wild type HY (p < 0.05, p < 0.01) (Figure 1), Before the osmotic stress treatment, the chlorophyll contents ofthe shoot tissues did not show significant difference between thethree overexpressing transgenic lines and the wild type ZH11 orbetween two T-DNA insertional mutant lines and the wild type HY. However, osmotic stress treatments decreased the chlorophyll con-tents of all these rice lines. There were significant differences in thechlorophyll contents between the overexpressing lines or T-DNAinsertional mutant lines and their respective wild types (p < 0.01)(Figure 1), suggesting that OsCCD1 genes enhanced the osmotic stresstolerance of rice seedlings and the physiological metabolism[1].
Figure 7. Salt tolerance in rice seedlings hydroponically cultured and treated with 150 mM NaCl for 3 days followed by recovery for 7 days. [1].
  • When the ten-day-old rice seedlings were treated with 150 mM NaCl for 3 days followed by recovery for 7 days, OsCCD1-overexpressing lines showed significantly higher survival rates(77.4%, 78.2% and 81.1%) than the wild type ZH11 (62.3%) (p < 0.05),the T-DNA mutant lines showed significantly lower survival rates(44.2% and 45.5%) than the wild type HY (64.9%) (p < 0.01) (Figure 2). In addition, OsCCD1-overexpressing lines had significantlybeen higher soluble in sugar and Proline (Pro) contents and signif-icantly higher MDA contents in the shoots of rice seedlings thanthe wild type ZH11 (p < 0.01). However, T-DNA mutant lines hadextravagantly lower contents of soluble sugars and Pro but sig-nificantly higher contents of MDA in the shoots of rice seedlingsthan the wild type HY (p < 0.05, p < 0.01) (Figure 2). Before the saltstress treatments, the chlorophyll contents of the shoot tissues didnot show significant difference between the three overexpressingtransgenic lines and the wild type ZH11 or between two T-DNAinsertional mutant lines and the wild type HY. However, comparedwith their respective wild type rice lines, chlorophyll contentsshowed significant difference between the overexpressing linesor T-DNA insertional mutant lines and their respective wild types(p < 0.05, p < 0.01) (Figure 2), suggesting that OsCCD1 genes enhancedthe salt stress tolerance of rice seedlings and the physiological metabolism[1].

Expression Pattern

  • OsCCD1 gene was induced by osmotic and salt stress viacalcium-mediated ABA signal, and Ca2+ played as a mediatorin the transduction of the ABA signal in rice seedlings[1].

Subcellular localization

  • Transient expression ofgreen fluorescent protein (GFP)-tagged OsCCD1 in rice protoplasts showed that OsCCD1 was localized inthe nucleus and cytosol of rice cells in the rice seedlings(Figure 3)[1].

Homologues

  • Phylogenetic and EF-hand motif analysis showed that, basedon the degree of amino acid sequence similarity of different plantspecies, the CCD1 homologues in plants can be categorized intothree groups (Groups I, II and III), containing nine, four and onemembers, respectively. Six homologous CCD1 proteins from mono-cot cereal crops clustered together in the Group I. In addition, OsCCD1 manifested the highest sequence identity with TaCCD1 and BdPBP1, and the conserved one-EF-hand; Group II consisted of genesequences from dicot species, and the Arabidopsis AtKIC was clas-sified as Group III (Figs. S1 and S2). Notably, all of these 14 proteinspossessed one EF-hand domain with the conserved Ca2+-binding loop DxDGDGALxxx, implying that they are conservedin the calcium signal transduction in the plant growth and stressresponses[1].

Knowledge Extension

  • Calcium ion, Ca2+, is adopted as a macroelement in the growthand development process, and a ubiquitous secondary messengerinvolved in the signal transduction of the development and stressresponse in plants. These Ca2+ signaturesare decoded by several types of Ca2+ sensor proteins that contain a high-affinity Ca2+-binding helix-loop-helix structure, known as the EF-hand motif[2]. The binding of Ca2+-binding proteins(CaBPs) triggered a change in conformation and enzymatic activ-ity, followed by the participation of these activated Ca2+/Ca2+ sensor complexes in the induction of appropriate physiological responses, including ion transport, metabolism, post-translational protein modifications and gene expressions.
  • Based on the Ca2+-binding affinities and mode of actions, CaBPs can be classified into two groups: (1)Ca2+ sensors, translate thesignal to various responses; (2) Ca2+ buffers, control the level offree Ca2+ ions in the cytoplasm.

Figure 3. Subcellular localizations of OsCCD1-GFP fusion protein in the rice mesophyll protoplasts and epidermal protoplasts.[1].

Labs working on this gene

  • MOA Key Laboratory of Crop Ecophysiology and Farming System in the Middle Reaches of the Yangtze River
  • College of Plant Science and Technology
  • Huazhong Agricultural University, Wuhan 430070, PR China

References

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 Jing P, Zou J, Kong L, Hu S, Wang B, Yang J, Xie G. OsCCD1, a novel small calcium-binding protein with one EF-hand motif, positively regulates osmotic and salt tolerance in rice. Plant Sci. 2016 Jun;247:104-14. doi: 10.1016/j.plantsci.2016.03.011. Epub 2016 Mar 24. PubMed PMID: 27095404.
  2. I.S. Day, V.S. Reddy, G. Shad Ali, A.S. Reddy, Analysis of EF-hand-containingproteins in arabidopsis, Genome Biol. 3 (2002), RESEARCH0056.

Structured Information